Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H5A6

Protein Details
Accession A0A2I1H5A6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-53ENIVKLFKRKPSRRKVHIKYPVLHydrophilic
NLS Segment(s)
PositionSequence
38-45KRKPSRRK
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences MNNMTISRELEMLRQEVTRIQIFPPPINDFENIVKLFKRKPSRRKVHIKYPVLLNFFIKEQAQQTYKQCVIDKIIRELWNSTTRNNRIIYIDLCNQISLRINN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.21
5 0.2
6 0.19
7 0.18
8 0.21
9 0.23
10 0.24
11 0.26
12 0.26
13 0.25
14 0.26
15 0.26
16 0.25
17 0.24
18 0.27
19 0.23
20 0.21
21 0.2
22 0.2
23 0.23
24 0.28
25 0.37
26 0.42
27 0.52
28 0.62
29 0.7
30 0.78
31 0.86
32 0.85
33 0.85
34 0.85
35 0.79
36 0.7
37 0.67
38 0.61
39 0.52
40 0.45
41 0.35
42 0.25
43 0.22
44 0.2
45 0.14
46 0.11
47 0.1
48 0.14
49 0.15
50 0.18
51 0.21
52 0.26
53 0.27
54 0.29
55 0.29
56 0.26
57 0.3
58 0.32
59 0.31
60 0.3
61 0.35
62 0.34
63 0.34
64 0.34
65 0.34
66 0.37
67 0.35
68 0.35
69 0.38
70 0.4
71 0.43
72 0.43
73 0.4
74 0.35
75 0.38
76 0.36
77 0.32
78 0.34
79 0.33
80 0.32
81 0.3
82 0.28
83 0.26