Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G0L0

Protein Details
Accession A0A2I1G0L0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
414-434FVASIFAYKRIKKNHKNQSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 5, mito 4, golg 3, extr 2, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13418  Kelch_4  
PF13854  Kelch_5  
Amino Acid Sequences MCKLILKISQIFSFLMSTQKNSAMIYKILLIFVLSQLFLFLNILGIGQNYIPEPRVGQAAVLIEDKIYYIGGYKFNQSQLTSDVFYLDVNEFKFIWTDLVSLGANLTLTSWHTASPNGISLDSIFILGGVHLDETNMNYVYKLDIKTNIISAPIIQGKTPQPRQGMKSVVSIEGKIYIYGGYVGSGDNIIFVNSLDILDTINLSWSVGSLVNSPVGRIYYTASFLDDGTIYYIGGKVDRNNFSPMTEIYQYDTIGDKWSLKTATAEVAETMPGPRIGHTAVLLGSGKIIVYGGLYYNDDIPYGIPSKETIAMLDITTLVWSIPPLENFNNIPKLAFHSANLLYDAAMIITFGQKYKWINVILDAPTKDSIKPKSKSEIPSPNISKMSPPQSNSHSKIIIVCVSIGSVAAGLTLFVASIFAYKRIKKNHKNQSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.22
4 0.23
5 0.24
6 0.26
7 0.26
8 0.25
9 0.28
10 0.25
11 0.24
12 0.23
13 0.24
14 0.22
15 0.21
16 0.2
17 0.16
18 0.13
19 0.14
20 0.14
21 0.09
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.07
28 0.07
29 0.06
30 0.07
31 0.06
32 0.06
33 0.07
34 0.06
35 0.07
36 0.07
37 0.09
38 0.1
39 0.1
40 0.11
41 0.11
42 0.14
43 0.13
44 0.12
45 0.13
46 0.14
47 0.15
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.09
54 0.07
55 0.05
56 0.07
57 0.1
58 0.15
59 0.16
60 0.2
61 0.23
62 0.26
63 0.29
64 0.27
65 0.26
66 0.25
67 0.27
68 0.24
69 0.21
70 0.19
71 0.16
72 0.15
73 0.15
74 0.13
75 0.12
76 0.11
77 0.13
78 0.12
79 0.12
80 0.13
81 0.11
82 0.12
83 0.1
84 0.1
85 0.08
86 0.1
87 0.1
88 0.09
89 0.09
90 0.07
91 0.07
92 0.06
93 0.06
94 0.05
95 0.06
96 0.08
97 0.08
98 0.09
99 0.09
100 0.1
101 0.12
102 0.12
103 0.15
104 0.14
105 0.13
106 0.13
107 0.12
108 0.13
109 0.12
110 0.1
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.1
128 0.13
129 0.14
130 0.13
131 0.16
132 0.18
133 0.19
134 0.2
135 0.19
136 0.15
137 0.14
138 0.13
139 0.14
140 0.14
141 0.14
142 0.12
143 0.16
144 0.21
145 0.3
146 0.33
147 0.34
148 0.37
149 0.41
150 0.44
151 0.46
152 0.45
153 0.38
154 0.39
155 0.35
156 0.33
157 0.29
158 0.26
159 0.21
160 0.19
161 0.18
162 0.13
163 0.11
164 0.08
165 0.07
166 0.08
167 0.07
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.03
193 0.05
194 0.05
195 0.06
196 0.06
197 0.07
198 0.09
199 0.09
200 0.09
201 0.09
202 0.08
203 0.08
204 0.07
205 0.08
206 0.07
207 0.09
208 0.09
209 0.09
210 0.09
211 0.09
212 0.09
213 0.08
214 0.07
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.05
221 0.06
222 0.07
223 0.09
224 0.15
225 0.18
226 0.2
227 0.22
228 0.22
229 0.22
230 0.23
231 0.2
232 0.18
233 0.17
234 0.15
235 0.14
236 0.15
237 0.15
238 0.14
239 0.14
240 0.1
241 0.11
242 0.11
243 0.11
244 0.1
245 0.13
246 0.13
247 0.12
248 0.13
249 0.12
250 0.14
251 0.13
252 0.13
253 0.1
254 0.1
255 0.1
256 0.09
257 0.09
258 0.07
259 0.07
260 0.07
261 0.07
262 0.08
263 0.09
264 0.09
265 0.09
266 0.09
267 0.08
268 0.1
269 0.09
270 0.08
271 0.07
272 0.07
273 0.06
274 0.05
275 0.05
276 0.03
277 0.03
278 0.04
279 0.04
280 0.06
281 0.06
282 0.07
283 0.08
284 0.08
285 0.08
286 0.08
287 0.08
288 0.09
289 0.11
290 0.1
291 0.09
292 0.1
293 0.12
294 0.14
295 0.14
296 0.11
297 0.11
298 0.12
299 0.11
300 0.11
301 0.09
302 0.07
303 0.07
304 0.07
305 0.05
306 0.04
307 0.04
308 0.07
309 0.09
310 0.1
311 0.14
312 0.15
313 0.19
314 0.21
315 0.26
316 0.28
317 0.26
318 0.25
319 0.21
320 0.26
321 0.28
322 0.26
323 0.21
324 0.23
325 0.24
326 0.25
327 0.25
328 0.19
329 0.14
330 0.14
331 0.13
332 0.07
333 0.06
334 0.05
335 0.04
336 0.06
337 0.07
338 0.07
339 0.08
340 0.11
341 0.14
342 0.17
343 0.22
344 0.23
345 0.23
346 0.25
347 0.3
348 0.3
349 0.33
350 0.3
351 0.27
352 0.28
353 0.28
354 0.28
355 0.3
356 0.36
357 0.4
358 0.44
359 0.47
360 0.53
361 0.59
362 0.63
363 0.66
364 0.68
365 0.63
366 0.69
367 0.68
368 0.65
369 0.6
370 0.54
371 0.49
372 0.46
373 0.51
374 0.46
375 0.45
376 0.44
377 0.49
378 0.59
379 0.58
380 0.57
381 0.49
382 0.44
383 0.44
384 0.42
385 0.37
386 0.28
387 0.24
388 0.17
389 0.16
390 0.15
391 0.12
392 0.09
393 0.06
394 0.05
395 0.05
396 0.04
397 0.04
398 0.04
399 0.04
400 0.04
401 0.04
402 0.04
403 0.04
404 0.07
405 0.09
406 0.14
407 0.21
408 0.27
409 0.36
410 0.46
411 0.58
412 0.65
413 0.75
414 0.81