Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GW30

Protein Details
Accession A0A2I1GW30    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-51KVMGSKRKPKHRGPFNSDTCHydrophilic
NLS Segment(s)
PositionSequence
37-42KRKPKH
Subcellular Location(s) nucl 12, cyto_nucl 9.666, mito_nucl 9.333, cyto 6, mito 5.5, cyto_pero 3.833
Family & Domain DBs
Amino Acid Sequences MDTGWLNCEDGDPNVTFHSRDITANPYWLHAKVMGSKRKPKHRGPFNSDTCFKLTGNVFKWSFDQQDMSYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.14
5 0.17
6 0.15
7 0.15
8 0.16
9 0.19
10 0.18
11 0.21
12 0.21
13 0.19
14 0.19
15 0.19
16 0.18
17 0.14
18 0.14
19 0.18
20 0.26
21 0.32
22 0.35
23 0.43
24 0.49
25 0.58
26 0.65
27 0.67
28 0.7
29 0.73
30 0.78
31 0.79
32 0.82
33 0.79
34 0.79
35 0.71
36 0.63
37 0.55
38 0.47
39 0.38
40 0.32
41 0.28
42 0.29
43 0.3
44 0.36
45 0.34
46 0.33
47 0.36
48 0.36
49 0.35
50 0.3
51 0.3