Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GUA7

Protein Details
Accession A0A2I1GUA7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-66LKESKKKSSNTRYKQSRKARRKRSKTKAATSRNIKTHydrophilic
NLS Segment(s)
PositionSequence
12-81EIKRQTRAMTRKSGKQKEILKESKKKSSNTRYKQSRKARRKRSKTKAATSRNIKTKRSVRMQLIERKADR
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAYPYTRRDKSEIKRQTRAMTRKSGKQKEILKESKKKSSNTRYKQSRKARRKRSKTKAATSRNIKTKRSVRMQLIERKADRKLQAKIEKLELENTKNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.76
4 0.76
5 0.75
6 0.7
7 0.71
8 0.68
9 0.69
10 0.75
11 0.75
12 0.68
13 0.68
14 0.7
15 0.67
16 0.72
17 0.72
18 0.7
19 0.71
20 0.72
21 0.74
22 0.71
23 0.67
24 0.67
25 0.69
26 0.71
27 0.7
28 0.75
29 0.77
30 0.79
31 0.85
32 0.85
33 0.85
34 0.85
35 0.87
36 0.89
37 0.89
38 0.92
39 0.93
40 0.92
41 0.92
42 0.9
43 0.9
44 0.89
45 0.86
46 0.84
47 0.81
48 0.79
49 0.77
50 0.74
51 0.66
52 0.64
53 0.63
54 0.63
55 0.63
56 0.62
57 0.59
58 0.61
59 0.67
60 0.68
61 0.67
62 0.66
63 0.61
64 0.57
65 0.54
66 0.53
67 0.51
68 0.49
69 0.49
70 0.52
71 0.58
72 0.61
73 0.62
74 0.62
75 0.6
76 0.54
77 0.56
78 0.5
79 0.47