Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P128

Protein Details
Accession J3P128    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-94KPPPPPPTTKKQHHTPKPPPHHNTTTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10extr 10, cyto 2, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRLLSVTSAAGLAATVAATGKHFTTTTITIPVYTTYCPEPTTFTHKNHTYTVTKATTYTVCETTTIKKPPPPPPTTKKQHHTPKPPPHHNTTTCVMALGIAIAAFVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.05
6 0.06
7 0.06
8 0.08
9 0.08
10 0.09
11 0.13
12 0.15
13 0.16
14 0.19
15 0.18
16 0.17
17 0.17
18 0.18
19 0.15
20 0.13
21 0.14
22 0.12
23 0.13
24 0.13
25 0.13
26 0.15
27 0.16
28 0.25
29 0.28
30 0.28
31 0.35
32 0.37
33 0.4
34 0.38
35 0.4
36 0.33
37 0.3
38 0.33
39 0.27
40 0.24
41 0.21
42 0.21
43 0.17
44 0.18
45 0.18
46 0.14
47 0.13
48 0.14
49 0.15
50 0.18
51 0.24
52 0.25
53 0.25
54 0.29
55 0.36
56 0.45
57 0.52
58 0.54
59 0.56
60 0.6
61 0.68
62 0.73
63 0.75
64 0.72
65 0.74
66 0.78
67 0.8
68 0.83
69 0.84
70 0.85
71 0.87
72 0.9
73 0.86
74 0.84
75 0.83
76 0.76
77 0.7
78 0.63
79 0.56
80 0.46
81 0.4
82 0.31
83 0.21
84 0.18
85 0.13
86 0.09
87 0.04