Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GS46

Protein Details
Accession A0A2I1GS46   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
307-326REFAKSCKLNKLKCYQDRSHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002885  Pentatricopeptide_repeat  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF01535  PPR  
PF13812  PPR_3  
PROSITE View protein in PROSITE  
PS51375  PPR  
Amino Acid Sequences MRQIFNEIVIRNIQPDNFTYCCLMDGFVSNNDFRSAITLLNDMQNRNLKLDAHVYTVLIKAYMKIGNFSKAKSLYETMIKDKVDPTFVTYAVLIDGHARIGELDFSRKLLTELISHGTMNQITYNKVLSPDIFTPLMDAYAKQGLTEPARAIFEEMTTVGAKHNLYVYTILMDAYYRGHNYEAVWQMWKLTIKIFVTPLSKSKIYEQLLDLQQNEQNEHKENSSLAESNVKGWEKGLALSNIYEEKFSTQSVKYRQELLKNSAKFYPQKKTLFLLANYINQGKDNKKITQYLKELKEEFPEVFYITREFAKSCKLNKLKCYQDRSHSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.24
5 0.25
6 0.24
7 0.22
8 0.22
9 0.2
10 0.18
11 0.13
12 0.14
13 0.16
14 0.17
15 0.2
16 0.19
17 0.2
18 0.2
19 0.19
20 0.17
21 0.18
22 0.15
23 0.14
24 0.15
25 0.15
26 0.16
27 0.22
28 0.25
29 0.21
30 0.26
31 0.32
32 0.31
33 0.32
34 0.32
35 0.27
36 0.27
37 0.32
38 0.28
39 0.25
40 0.25
41 0.23
42 0.22
43 0.23
44 0.2
45 0.14
46 0.13
47 0.09
48 0.12
49 0.14
50 0.13
51 0.16
52 0.18
53 0.25
54 0.27
55 0.27
56 0.3
57 0.3
58 0.31
59 0.3
60 0.3
61 0.26
62 0.31
63 0.33
64 0.3
65 0.33
66 0.32
67 0.3
68 0.3
69 0.29
70 0.25
71 0.22
72 0.22
73 0.2
74 0.19
75 0.19
76 0.16
77 0.15
78 0.12
79 0.12
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.08
89 0.08
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.13
96 0.12
97 0.12
98 0.1
99 0.12
100 0.14
101 0.15
102 0.14
103 0.14
104 0.13
105 0.12
106 0.11
107 0.12
108 0.1
109 0.1
110 0.11
111 0.12
112 0.11
113 0.12
114 0.12
115 0.1
116 0.13
117 0.13
118 0.15
119 0.15
120 0.14
121 0.13
122 0.13
123 0.13
124 0.09
125 0.08
126 0.07
127 0.1
128 0.1
129 0.09
130 0.1
131 0.12
132 0.13
133 0.14
134 0.13
135 0.11
136 0.12
137 0.12
138 0.12
139 0.09
140 0.08
141 0.07
142 0.07
143 0.07
144 0.06
145 0.07
146 0.06
147 0.08
148 0.08
149 0.07
150 0.09
151 0.07
152 0.08
153 0.09
154 0.08
155 0.07
156 0.07
157 0.07
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.06
164 0.07
165 0.07
166 0.08
167 0.08
168 0.14
169 0.15
170 0.15
171 0.16
172 0.15
173 0.16
174 0.17
175 0.18
176 0.12
177 0.1
178 0.14
179 0.14
180 0.15
181 0.16
182 0.17
183 0.18
184 0.19
185 0.21
186 0.21
187 0.21
188 0.21
189 0.24
190 0.29
191 0.28
192 0.29
193 0.28
194 0.3
195 0.32
196 0.33
197 0.3
198 0.24
199 0.23
200 0.22
201 0.22
202 0.17
203 0.17
204 0.19
205 0.2
206 0.18
207 0.18
208 0.17
209 0.18
210 0.18
211 0.17
212 0.14
213 0.17
214 0.17
215 0.18
216 0.22
217 0.21
218 0.18
219 0.18
220 0.19
221 0.15
222 0.16
223 0.18
224 0.14
225 0.15
226 0.15
227 0.16
228 0.16
229 0.16
230 0.15
231 0.11
232 0.13
233 0.13
234 0.14
235 0.16
236 0.16
237 0.23
238 0.3
239 0.37
240 0.36
241 0.43
242 0.46
243 0.5
244 0.54
245 0.54
246 0.55
247 0.5
248 0.51
249 0.47
250 0.48
251 0.47
252 0.47
253 0.5
254 0.5
255 0.52
256 0.53
257 0.53
258 0.54
259 0.54
260 0.48
261 0.45
262 0.4
263 0.39
264 0.39
265 0.37
266 0.31
267 0.27
268 0.31
269 0.27
270 0.32
271 0.34
272 0.36
273 0.4
274 0.47
275 0.51
276 0.55
277 0.61
278 0.63
279 0.63
280 0.65
281 0.62
282 0.56
283 0.56
284 0.49
285 0.41
286 0.33
287 0.29
288 0.23
289 0.21
290 0.21
291 0.17
292 0.16
293 0.18
294 0.18
295 0.18
296 0.18
297 0.27
298 0.32
299 0.36
300 0.45
301 0.51
302 0.57
303 0.65
304 0.73
305 0.74
306 0.76
307 0.8
308 0.77