Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HGM9

Protein Details
Accession A0A2I1HGM9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32SQPISQSQRKLRRLNPKLRHLKRLKPSQQHydrophilic
NLS Segment(s)
PositionSequence
13-26KLRRLNPKLRHLKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MIISQPISQSQRKLRRLNPKLRHLKRLKPSQQMLEPFQVLNHRYLMKPGQQVLESMRPVQPILYILIRTLLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.79
4 0.83
5 0.82
6 0.83
7 0.85
8 0.83
9 0.85
10 0.81
11 0.8
12 0.79
13 0.8
14 0.77
15 0.75
16 0.73
17 0.68
18 0.67
19 0.61
20 0.55
21 0.46
22 0.39
23 0.29
24 0.26
25 0.24
26 0.19
27 0.16
28 0.16
29 0.14
30 0.14
31 0.17
32 0.19
33 0.21
34 0.24
35 0.25
36 0.25
37 0.24
38 0.25
39 0.27
40 0.3
41 0.26
42 0.25
43 0.24
44 0.23
45 0.23
46 0.22
47 0.18
48 0.13
49 0.15
50 0.16
51 0.15
52 0.14