Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G087

Protein Details
Accession A0A2I1G087    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-287HVFNCLCTRYRRKLVRKLKSKYEPIPFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, E.R. 6, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIAENKRSTEPFSFIILKKICSFLFIIILIFYTIGQFSQFSESTYNPNLIISQQRMDKKDTNITIILCGSTLNCTNYKERCKYGPAGYKNVDNTTITTCSQYFLGFQKKMMIEVTPINITAGYLYLEGIEIDSNNRYYTNGTFFDVESGLHYMNGYTNVVHYSPIIKKRITNKYVYGLAGGEEEGYVDFDAYLDIKTSTPDKTTLILKPKSMNIYYQKESYYDLNSITSNIGGFFGFLSGIFVFLFGEPKLAPWGFLQTHVFNCLCTRYRRKLVRKLKSKYEPIPFVSGRTKNFTLEERIQSIENLLEEYYLNTDFLNLLLEDNKDNKVYDKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.41
4 0.39
5 0.37
6 0.39
7 0.33
8 0.28
9 0.28
10 0.21
11 0.22
12 0.19
13 0.17
14 0.14
15 0.14
16 0.12
17 0.1
18 0.09
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.13
26 0.13
27 0.14
28 0.17
29 0.18
30 0.23
31 0.25
32 0.25
33 0.2
34 0.2
35 0.19
36 0.19
37 0.24
38 0.21
39 0.23
40 0.28
41 0.34
42 0.37
43 0.42
44 0.45
45 0.44
46 0.5
47 0.48
48 0.46
49 0.42
50 0.4
51 0.36
52 0.3
53 0.25
54 0.16
55 0.14
56 0.1
57 0.1
58 0.12
59 0.13
60 0.15
61 0.18
62 0.24
63 0.31
64 0.39
65 0.42
66 0.44
67 0.45
68 0.48
69 0.51
70 0.54
71 0.56
72 0.52
73 0.55
74 0.53
75 0.53
76 0.51
77 0.47
78 0.39
79 0.3
80 0.27
81 0.23
82 0.23
83 0.2
84 0.19
85 0.17
86 0.16
87 0.16
88 0.14
89 0.13
90 0.16
91 0.23
92 0.22
93 0.22
94 0.27
95 0.27
96 0.28
97 0.26
98 0.21
99 0.15
100 0.17
101 0.18
102 0.13
103 0.13
104 0.12
105 0.11
106 0.1
107 0.08
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.09
125 0.11
126 0.14
127 0.14
128 0.15
129 0.15
130 0.15
131 0.16
132 0.14
133 0.12
134 0.09
135 0.09
136 0.08
137 0.07
138 0.07
139 0.06
140 0.06
141 0.07
142 0.07
143 0.05
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.1
150 0.14
151 0.19
152 0.22
153 0.21
154 0.25
155 0.34
156 0.44
157 0.43
158 0.43
159 0.4
160 0.41
161 0.43
162 0.39
163 0.3
164 0.2
165 0.17
166 0.14
167 0.11
168 0.07
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.06
184 0.08
185 0.09
186 0.1
187 0.11
188 0.12
189 0.13
190 0.17
191 0.21
192 0.28
193 0.29
194 0.3
195 0.31
196 0.33
197 0.36
198 0.33
199 0.34
200 0.33
201 0.38
202 0.39
203 0.38
204 0.35
205 0.32
206 0.33
207 0.29
208 0.24
209 0.18
210 0.17
211 0.16
212 0.15
213 0.15
214 0.14
215 0.11
216 0.09
217 0.08
218 0.08
219 0.06
220 0.06
221 0.05
222 0.05
223 0.05
224 0.04
225 0.06
226 0.05
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.08
233 0.06
234 0.08
235 0.07
236 0.08
237 0.13
238 0.12
239 0.13
240 0.12
241 0.18
242 0.17
243 0.21
244 0.23
245 0.21
246 0.23
247 0.26
248 0.25
249 0.19
250 0.2
251 0.23
252 0.23
253 0.29
254 0.37
255 0.42
256 0.52
257 0.62
258 0.7
259 0.76
260 0.83
261 0.85
262 0.88
263 0.86
264 0.87
265 0.87
266 0.86
267 0.83
268 0.81
269 0.77
270 0.7
271 0.7
272 0.6
273 0.55
274 0.55
275 0.52
276 0.46
277 0.47
278 0.45
279 0.4
280 0.42
281 0.41
282 0.4
283 0.42
284 0.44
285 0.39
286 0.39
287 0.37
288 0.34
289 0.32
290 0.25
291 0.19
292 0.15
293 0.12
294 0.11
295 0.1
296 0.11
297 0.12
298 0.11
299 0.11
300 0.1
301 0.1
302 0.1
303 0.1
304 0.11
305 0.08
306 0.09
307 0.11
308 0.13
309 0.16
310 0.18
311 0.21
312 0.2
313 0.21