Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FTM8

Protein Details
Accession A0A2I1FTM8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-111GKNYRYQPVHMKKSKPNQQNKRNKRKHydrophilic
NLS Segment(s)
PositionSequence
97-111KKSKPNQQNKRNKRK
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MKTSFINLIINLISKLKNGTNNAPRRQNAWILYRRDKSMNKEFEGLTTAIVSLKIREMWEKETWEVKELFSALSRLAEKRHIEQYGKNYRYQPVHMKKSKPNQQNKRNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.23
5 0.26
6 0.35
7 0.42
8 0.51
9 0.58
10 0.63
11 0.6
12 0.57
13 0.57
14 0.53
15 0.48
16 0.48
17 0.48
18 0.47
19 0.55
20 0.54
21 0.53
22 0.54
23 0.53
24 0.52
25 0.54
26 0.53
27 0.46
28 0.46
29 0.43
30 0.37
31 0.36
32 0.28
33 0.19
34 0.13
35 0.11
36 0.08
37 0.09
38 0.08
39 0.05
40 0.06
41 0.06
42 0.07
43 0.09
44 0.1
45 0.14
46 0.17
47 0.18
48 0.19
49 0.23
50 0.23
51 0.24
52 0.22
53 0.18
54 0.17
55 0.15
56 0.14
57 0.1
58 0.1
59 0.08
60 0.1
61 0.11
62 0.11
63 0.12
64 0.18
65 0.2
66 0.23
67 0.29
68 0.31
69 0.32
70 0.36
71 0.45
72 0.5
73 0.49
74 0.49
75 0.46
76 0.48
77 0.5
78 0.51
79 0.52
80 0.51
81 0.59
82 0.63
83 0.67
84 0.71
85 0.78
86 0.83
87 0.82
88 0.83
89 0.83
90 0.87
91 0.91