Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HRM4

Protein Details
Accession A0A2I1HRM4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-49IPNLKKAQLKPKTKNTPDKKKSHydrophilic
NLS Segment(s)
PositionSequence
32-69KKAQLKPKTKNTPDKKKSGDTGKVSKQAKKPSKGGAGG
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences LGDHTKGLRSTTFCLTDREGVEWCRHSIPNLKKAQLKPKTKNTPDKKKSGDTGKVSKQAKKPSKGGAGGNKDNKEVLAEILSLLRKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.37
4 0.35
5 0.33
6 0.29
7 0.25
8 0.28
9 0.27
10 0.26
11 0.24
12 0.23
13 0.23
14 0.3
15 0.35
16 0.4
17 0.43
18 0.45
19 0.49
20 0.53
21 0.61
22 0.62
23 0.64
24 0.63
25 0.68
26 0.75
27 0.76
28 0.81
29 0.81
30 0.83
31 0.79
32 0.79
33 0.72
34 0.66
35 0.64
36 0.62
37 0.59
38 0.54
39 0.56
40 0.54
41 0.57
42 0.56
43 0.57
44 0.56
45 0.58
46 0.61
47 0.6
48 0.59
49 0.59
50 0.63
51 0.6
52 0.6
53 0.59
54 0.58
55 0.61
56 0.64
57 0.58
58 0.52
59 0.48
60 0.41
61 0.34
62 0.26
63 0.19
64 0.13
65 0.12
66 0.11
67 0.15
68 0.15