Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FZM6

Protein Details
Accession A0A2I1FZM6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-83RSGSGRRMRNGSRRRRVRGGVBasic
NLS Segment(s)
PositionSequence
63-81RSGSGRRMRNGSRRRRVRG
Subcellular Location(s) nucl 16, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MDPAFGLYDEYRLTTLHVTGCCAHITRLIKKESESEEWESEEEWEWEWEEDEEWESEEESQRRSGSGRRMRNGSRRRRVRGGVGVGVGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.15
5 0.17
6 0.17
7 0.18
8 0.17
9 0.17
10 0.16
11 0.17
12 0.22
13 0.26
14 0.31
15 0.32
16 0.32
17 0.32
18 0.37
19 0.36
20 0.35
21 0.33
22 0.31
23 0.3
24 0.29
25 0.29
26 0.23
27 0.2
28 0.16
29 0.12
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.11
45 0.12
46 0.13
47 0.15
48 0.14
49 0.15
50 0.16
51 0.21
52 0.27
53 0.36
54 0.43
55 0.46
56 0.53
57 0.6
58 0.69
59 0.74
60 0.74
61 0.76
62 0.77
63 0.8
64 0.81
65 0.79
66 0.78
67 0.77
68 0.72
69 0.65
70 0.56