Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HC66

Protein Details
Accession A0A2I1HC66   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
152-178ENKEMDNNKKQRRCKGCQETGHDLRNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MTDDDYTLLDTVSLVKNNYTEVALNEINFKYINQVRGEQVYTESLQSIVSAKAKYGRSLGLARKLLDLAQKLDCFNEVNGMFQNFIDNKQQELLQKQQEITDKDVNEKENEKNCFNPITSRRRGRPPNRYLSEGEIAKQKKVKVDHEGNLLENKEMDNNKKQRRCKGCQETGHDLRNCKNKVLGEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.17
5 0.18
6 0.16
7 0.14
8 0.13
9 0.18
10 0.18
11 0.18
12 0.21
13 0.19
14 0.19
15 0.18
16 0.17
17 0.19
18 0.22
19 0.26
20 0.24
21 0.27
22 0.28
23 0.31
24 0.32
25 0.25
26 0.23
27 0.21
28 0.19
29 0.17
30 0.15
31 0.12
32 0.11
33 0.11
34 0.1
35 0.1
36 0.12
37 0.11
38 0.12
39 0.18
40 0.19
41 0.21
42 0.21
43 0.2
44 0.2
45 0.26
46 0.3
47 0.32
48 0.33
49 0.32
50 0.31
51 0.31
52 0.28
53 0.26
54 0.23
55 0.18
56 0.19
57 0.19
58 0.18
59 0.18
60 0.18
61 0.15
62 0.13
63 0.16
64 0.12
65 0.12
66 0.13
67 0.13
68 0.13
69 0.11
70 0.14
71 0.09
72 0.11
73 0.15
74 0.15
75 0.15
76 0.15
77 0.17
78 0.16
79 0.19
80 0.22
81 0.2
82 0.21
83 0.21
84 0.24
85 0.26
86 0.27
87 0.28
88 0.28
89 0.25
90 0.27
91 0.29
92 0.27
93 0.25
94 0.26
95 0.26
96 0.28
97 0.32
98 0.3
99 0.29
100 0.3
101 0.3
102 0.27
103 0.3
104 0.31
105 0.36
106 0.43
107 0.49
108 0.52
109 0.6
110 0.7
111 0.72
112 0.75
113 0.75
114 0.77
115 0.74
116 0.73
117 0.66
118 0.6
119 0.57
120 0.46
121 0.39
122 0.36
123 0.33
124 0.32
125 0.34
126 0.3
127 0.3
128 0.35
129 0.39
130 0.41
131 0.48
132 0.49
133 0.52
134 0.52
135 0.48
136 0.47
137 0.42
138 0.32
139 0.25
140 0.21
141 0.2
142 0.22
143 0.26
144 0.32
145 0.41
146 0.51
147 0.59
148 0.66
149 0.71
150 0.77
151 0.8
152 0.81
153 0.82
154 0.82
155 0.82
156 0.83
157 0.83
158 0.8
159 0.81
160 0.74
161 0.66
162 0.64
163 0.65
164 0.59
165 0.51
166 0.49
167 0.46