Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HA65

Protein Details
Accession A0A2I1HA65    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-101KALTTSFWTSKKRRKKLQRLIQHydrophilic
NLS Segment(s)
PositionSequence
90-95KKRRKK
Subcellular Location(s) mito 14.5, mito_nucl 13.833, nucl 12, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MFNRTYSINLRYEKIPQIKYIIIWNDIKIETQLRRFIRYYTNTVNLESFLLLNRNTKYDKLDIDYIDWSVTFEYVKENEKALTTSFWTSKKRRKKLQRLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.38
4 0.4
5 0.38
6 0.37
7 0.38
8 0.33
9 0.29
10 0.28
11 0.26
12 0.25
13 0.24
14 0.23
15 0.18
16 0.2
17 0.19
18 0.22
19 0.28
20 0.27
21 0.31
22 0.31
23 0.32
24 0.35
25 0.36
26 0.38
27 0.36
28 0.4
29 0.37
30 0.37
31 0.35
32 0.28
33 0.24
34 0.18
35 0.13
36 0.07
37 0.08
38 0.08
39 0.1
40 0.1
41 0.12
42 0.13
43 0.14
44 0.17
45 0.18
46 0.19
47 0.2
48 0.23
49 0.21
50 0.21
51 0.21
52 0.18
53 0.16
54 0.14
55 0.11
56 0.08
57 0.08
58 0.06
59 0.05
60 0.08
61 0.1
62 0.14
63 0.14
64 0.15
65 0.16
66 0.17
67 0.18
68 0.16
69 0.16
70 0.16
71 0.19
72 0.23
73 0.28
74 0.35
75 0.43
76 0.52
77 0.61
78 0.68
79 0.75
80 0.82
81 0.88