Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GAT8

Protein Details
Accession A0A2I1GAT8    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
208-237FIKRRNKLTETKSAKRRRKYEEKKRLCDKKBasic
NLS Segment(s)
PositionSequence
210-233KRRNKLTETKSAKRRRKYEEKKRL
236-236K
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MYKEKKEIYLPRRGINFIKQLAYKDKKPYQRYEGNTPIQYRVIYSRYREEDLELGTRKAEILMKRRVRGLANNKYKWHILKNGDVLSTPPSRLSYHVFKTRKSILKEVYIRSSDLAQLYSDVNSRQHFNELNDEIILNHTYDEDDFAMIKSFKEEQLPAVRTATNEDYRRVEHLYTKSKLTLQEVDKLRDECIHGDIRFDMSRIDPWFIKRRNKLTETKSAKRRRKYEEKKRLCDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.55
4 0.48
5 0.49
6 0.45
7 0.45
8 0.52
9 0.54
10 0.52
11 0.54
12 0.59
13 0.63
14 0.68
15 0.72
16 0.71
17 0.73
18 0.74
19 0.73
20 0.74
21 0.72
22 0.7
23 0.64
24 0.57
25 0.5
26 0.43
27 0.36
28 0.31
29 0.28
30 0.27
31 0.29
32 0.34
33 0.37
34 0.39
35 0.37
36 0.35
37 0.33
38 0.32
39 0.34
40 0.28
41 0.24
42 0.21
43 0.21
44 0.18
45 0.17
46 0.19
47 0.18
48 0.24
49 0.34
50 0.4
51 0.42
52 0.44
53 0.46
54 0.44
55 0.48
56 0.51
57 0.51
58 0.56
59 0.59
60 0.58
61 0.58
62 0.58
63 0.52
64 0.47
65 0.44
66 0.38
67 0.39
68 0.42
69 0.41
70 0.38
71 0.35
72 0.31
73 0.27
74 0.24
75 0.19
76 0.14
77 0.14
78 0.14
79 0.16
80 0.2
81 0.22
82 0.27
83 0.36
84 0.37
85 0.36
86 0.41
87 0.46
88 0.48
89 0.46
90 0.46
91 0.39
92 0.46
93 0.5
94 0.47
95 0.44
96 0.38
97 0.34
98 0.29
99 0.26
100 0.19
101 0.15
102 0.13
103 0.08
104 0.08
105 0.08
106 0.08
107 0.09
108 0.08
109 0.1
110 0.1
111 0.12
112 0.11
113 0.14
114 0.15
115 0.16
116 0.21
117 0.2
118 0.19
119 0.18
120 0.17
121 0.14
122 0.14
123 0.13
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.08
135 0.08
136 0.08
137 0.09
138 0.1
139 0.11
140 0.13
141 0.13
142 0.15
143 0.23
144 0.25
145 0.24
146 0.25
147 0.25
148 0.22
149 0.26
150 0.27
151 0.26
152 0.26
153 0.27
154 0.28
155 0.29
156 0.31
157 0.29
158 0.26
159 0.26
160 0.32
161 0.37
162 0.37
163 0.38
164 0.37
165 0.38
166 0.39
167 0.36
168 0.36
169 0.31
170 0.37
171 0.39
172 0.41
173 0.42
174 0.41
175 0.37
176 0.32
177 0.31
178 0.24
179 0.24
180 0.27
181 0.22
182 0.23
183 0.23
184 0.25
185 0.24
186 0.22
187 0.2
188 0.15
189 0.2
190 0.21
191 0.24
192 0.22
193 0.28
194 0.37
195 0.44
196 0.52
197 0.56
198 0.63
199 0.69
200 0.73
201 0.76
202 0.74
203 0.77
204 0.76
205 0.77
206 0.78
207 0.8
208 0.83
209 0.83
210 0.86
211 0.85
212 0.87
213 0.89
214 0.9
215 0.9
216 0.92
217 0.92