Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GNW4

Protein Details
Accession A0A2I1GNW4   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-57KRYQTPYFSPTRNKKRKKEKKVTHKLYFKTFHydrophilic
72-98KPYVQKIKLNNNKRTRRKPSKLCSDCEHydrophilic
NLS Segment(s)
PositionSequence
38-48RNKKRKKEKKV
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MYFNCTCKCDHDIAKFGNHSHNLKNIKRYQTPYFSPTRNKKRKKEKKVTHKLYFKTFVQMSSKNYGSRTCGKPYVQKIKLNNNKRTRRKPSKLCSDCEETNDYIKLLSSKVSRIEEIVDNFKNLPKNKTENKLSVFNAKFSLNNVPCELEYDLSNFTLENLQKLVIFTTQNCKPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.51
3 0.48
4 0.49
5 0.48
6 0.45
7 0.41
8 0.46
9 0.47
10 0.49
11 0.57
12 0.57
13 0.59
14 0.63
15 0.65
16 0.65
17 0.64
18 0.64
19 0.6
20 0.59
21 0.56
22 0.59
23 0.64
24 0.68
25 0.71
26 0.76
27 0.81
28 0.86
29 0.91
30 0.93
31 0.93
32 0.93
33 0.94
34 0.95
35 0.95
36 0.93
37 0.91
38 0.83
39 0.79
40 0.74
41 0.63
42 0.58
43 0.48
44 0.42
45 0.38
46 0.37
47 0.34
48 0.33
49 0.35
50 0.29
51 0.3
52 0.28
53 0.27
54 0.31
55 0.31
56 0.31
57 0.33
58 0.34
59 0.4
60 0.47
61 0.53
62 0.51
63 0.52
64 0.53
65 0.59
66 0.67
67 0.69
68 0.7
69 0.7
70 0.74
71 0.79
72 0.84
73 0.84
74 0.85
75 0.85
76 0.86
77 0.85
78 0.86
79 0.81
80 0.75
81 0.69
82 0.64
83 0.55
84 0.48
85 0.42
86 0.31
87 0.28
88 0.25
89 0.21
90 0.14
91 0.13
92 0.11
93 0.08
94 0.1
95 0.1
96 0.12
97 0.16
98 0.18
99 0.18
100 0.17
101 0.2
102 0.2
103 0.22
104 0.25
105 0.22
106 0.21
107 0.21
108 0.24
109 0.27
110 0.26
111 0.27
112 0.28
113 0.36
114 0.42
115 0.5
116 0.53
117 0.53
118 0.55
119 0.58
120 0.54
121 0.56
122 0.49
123 0.43
124 0.39
125 0.33
126 0.29
127 0.26
128 0.34
129 0.27
130 0.28
131 0.28
132 0.28
133 0.26
134 0.29
135 0.28
136 0.19
137 0.17
138 0.17
139 0.17
140 0.15
141 0.15
142 0.12
143 0.11
144 0.17
145 0.16
146 0.16
147 0.15
148 0.16
149 0.17
150 0.17
151 0.18
152 0.15
153 0.17
154 0.17
155 0.24
156 0.32