Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HM95

Protein Details
Accession A0A2I1HM95    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21GKSAKFYKRLSKKEKIVQSIHydrophilic
51-79KPSATTKITKKQNKRKKVKAVTNGNGNKNHydrophilic
NLS Segment(s)
PositionSequence
60-69KKQNKRKKVK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGKSAKFYKRLSKKEKIVQSIISNNNNNNNIKSESQSSILLSSQDSLNSAKPSATTKITKKQNKRKKVKAVTNGNGNKNNEKDYVDIFTGKELYKPLIGRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.8
4 0.73
5 0.68
6 0.65
7 0.63
8 0.6
9 0.58
10 0.52
11 0.47
12 0.5
13 0.49
14 0.45
15 0.38
16 0.35
17 0.31
18 0.29
19 0.29
20 0.26
21 0.23
22 0.24
23 0.23
24 0.2
25 0.17
26 0.17
27 0.14
28 0.11
29 0.1
30 0.08
31 0.08
32 0.08
33 0.08
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.12
40 0.13
41 0.16
42 0.2
43 0.23
44 0.32
45 0.42
46 0.5
47 0.58
48 0.67
49 0.74
50 0.8
51 0.85
52 0.87
53 0.88
54 0.9
55 0.89
56 0.88
57 0.88
58 0.84
59 0.84
60 0.81
61 0.76
62 0.72
63 0.66
64 0.61
65 0.53
66 0.5
67 0.42
68 0.36
69 0.32
70 0.28
71 0.29
72 0.24
73 0.23
74 0.2
75 0.2
76 0.22
77 0.2
78 0.19
79 0.17
80 0.18
81 0.21