Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P2Z9

Protein Details
Accession J3P2Z9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-85GRAGRHPRGFRRAKRVDTRLDBasic
NLS Segment(s)
PositionSequence
24-39GRNKEAGRKHGSRERS
65-79GRAGRHPRGFRRAKR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLGGVGVESEEKEGEFRHEVEKEGRNKEAGRKHGSRERSQPGKSEFPSRQLRSDGYVLGSAEPGGRAGRHPRGFRRAKRVDTRLDYIVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.19
5 0.2
6 0.22
7 0.27
8 0.34
9 0.37
10 0.38
11 0.38
12 0.36
13 0.38
14 0.43
15 0.44
16 0.44
17 0.45
18 0.44
19 0.48
20 0.52
21 0.56
22 0.54
23 0.54
24 0.56
25 0.55
26 0.54
27 0.53
28 0.52
29 0.52
30 0.48
31 0.47
32 0.39
33 0.39
34 0.47
35 0.43
36 0.41
37 0.37
38 0.37
39 0.33
40 0.33
41 0.26
42 0.18
43 0.18
44 0.15
45 0.13
46 0.12
47 0.09
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.09
54 0.16
55 0.25
56 0.32
57 0.38
58 0.45
59 0.55
60 0.65
61 0.7
62 0.74
63 0.74
64 0.77
65 0.81
66 0.8
67 0.8
68 0.77
69 0.74