Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HPG4

Protein Details
Accession A0A2I1HPG4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-33EDRGQSKREFKHPRSPRPQKKAKSDEKSTGKEBasic
NLS Segment(s)
PositionSequence
8-25KREFKHPRSPRPQKKAKS
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036537  Adaptor_Cbl_N_dom_sf  
Gene Ontology GO:0007166  P:cell surface receptor signaling pathway  
Amino Acid Sequences MEDRGQSKREFKHPRSPRPQKKAKSDEKSTGKEAIEAAVSFSKFIPLISEIGNVFNEILDLVEAAEHNKRTCGILRDRVNVAELAVRELRVRNKDKKDFFNSKNYKSLQNLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.88
4 0.89
5 0.89
6 0.93
7 0.91
8 0.91
9 0.91
10 0.9
11 0.88
12 0.84
13 0.83
14 0.81
15 0.77
16 0.69
17 0.64
18 0.53
19 0.45
20 0.37
21 0.28
22 0.21
23 0.16
24 0.14
25 0.12
26 0.11
27 0.11
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.1
37 0.1
38 0.11
39 0.11
40 0.09
41 0.08
42 0.06
43 0.06
44 0.04
45 0.04
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.04
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.11
58 0.15
59 0.2
60 0.24
61 0.32
62 0.36
63 0.4
64 0.41
65 0.4
66 0.37
67 0.31
68 0.25
69 0.19
70 0.15
71 0.15
72 0.14
73 0.14
74 0.14
75 0.18
76 0.24
77 0.3
78 0.37
79 0.43
80 0.53
81 0.62
82 0.68
83 0.74
84 0.77
85 0.78
86 0.76
87 0.77
88 0.76
89 0.72
90 0.73
91 0.66
92 0.64