Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H866

Protein Details
Accession A0A2I1H866    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-103EPDEAVPKIKKNKKKETNQKNYYVKIHydrophilic
NLS Segment(s)
PositionSequence
85-92KIKKNKKK
Subcellular Location(s) mito 20, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences IGTLHISFKKVSVKPFHVSAKPFMYRRDPSLWIGIGWDLWSNIGWRGPLDGIGWDFWIEERTNKQERLPPRLFSSKQEPDEAVPKIKKNKKKETNQKNYYVKILYFETIPFQKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.56
4 0.52
5 0.52
6 0.5
7 0.49
8 0.5
9 0.48
10 0.46
11 0.47
12 0.45
13 0.47
14 0.47
15 0.42
16 0.38
17 0.4
18 0.36
19 0.28
20 0.26
21 0.21
22 0.15
23 0.13
24 0.11
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.07
47 0.1
48 0.16
49 0.19
50 0.2
51 0.23
52 0.26
53 0.31
54 0.39
55 0.4
56 0.36
57 0.38
58 0.45
59 0.44
60 0.43
61 0.48
62 0.47
63 0.46
64 0.45
65 0.41
66 0.35
67 0.39
68 0.37
69 0.35
70 0.3
71 0.34
72 0.42
73 0.49
74 0.56
75 0.61
76 0.7
77 0.73
78 0.81
79 0.87
80 0.88
81 0.91
82 0.9
83 0.9
84 0.86
85 0.79
86 0.73
87 0.65
88 0.54
89 0.47
90 0.41
91 0.32
92 0.26
93 0.24
94 0.24
95 0.23