Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GIY8

Protein Details
Accession A0A2I1GIY8   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-108LQPNREKDTRKQCQKCSQRGHNRVTCKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAVYNEGSIDIAISTNSYDELIIGLCQGFLSSKQSIDSEQQIDLQNITNPVISTREGRLPSRAKRNLLSNIDNIQPSSEELQPNREKDTRKQCQKCSQRGHNRVTCKLLLVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.1
18 0.1
19 0.11
20 0.12
21 0.13
22 0.15
23 0.17
24 0.2
25 0.17
26 0.17
27 0.2
28 0.2
29 0.19
30 0.18
31 0.16
32 0.14
33 0.13
34 0.13
35 0.1
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.11
42 0.15
43 0.16
44 0.17
45 0.23
46 0.28
47 0.33
48 0.42
49 0.45
50 0.43
51 0.44
52 0.49
53 0.51
54 0.5
55 0.47
56 0.4
57 0.38
58 0.37
59 0.35
60 0.29
61 0.21
62 0.16
63 0.14
64 0.14
65 0.15
66 0.17
67 0.17
68 0.26
69 0.3
70 0.31
71 0.36
72 0.37
73 0.38
74 0.44
75 0.55
76 0.57
77 0.64
78 0.71
79 0.74
80 0.8
81 0.86
82 0.87
83 0.86
84 0.86
85 0.87
86 0.87
87 0.88
88 0.86
89 0.83
90 0.79
91 0.75
92 0.65