Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H556

Protein Details
Accession A0A2I1H556    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-82VSHYSPTIHKRRNRRKLRKRTCALYWIHydrophilic
NLS Segment(s)
PositionSequence
65-75KRRNRRKLRKR
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences RPNQTIDAWFKLSPRGKENVTGKVRVQISYEKIEYVEVNDFEKSTSLDNTLAQSYVSHYSPTIHKRRNRRKLRKRTCALYWIERLPVQVTNDPFANNIFNGTPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.38
4 0.46
5 0.49
6 0.5
7 0.48
8 0.47
9 0.43
10 0.45
11 0.45
12 0.37
13 0.35
14 0.3
15 0.3
16 0.32
17 0.31
18 0.24
19 0.23
20 0.23
21 0.21
22 0.17
23 0.17
24 0.12
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.11
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.11
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.1
43 0.1
44 0.09
45 0.09
46 0.11
47 0.16
48 0.24
49 0.31
50 0.36
51 0.42
52 0.53
53 0.64
54 0.73
55 0.8
56 0.83
57 0.86
58 0.9
59 0.95
60 0.95
61 0.91
62 0.88
63 0.82
64 0.78
65 0.73
66 0.69
67 0.63
68 0.54
69 0.49
70 0.42
71 0.38
72 0.32
73 0.3
74 0.26
75 0.27
76 0.26
77 0.27
78 0.27
79 0.26
80 0.25
81 0.23
82 0.21
83 0.16
84 0.16