Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G203

Protein Details
Accession A0A2I1G203    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37LQYRDKTTKTSRNQRTRFQRNCKRVFNWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MYRKRYENFLQYRDKTTKTSRNQRTRFQRNCKRVFNWMKDDPALTLDDHISRARQHRFLLKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.54
4 0.56
5 0.56
6 0.64
7 0.67
8 0.74
9 0.77
10 0.81
11 0.83
12 0.84
13 0.84
14 0.84
15 0.84
16 0.83
17 0.85
18 0.81
19 0.73
20 0.72
21 0.71
22 0.67
23 0.65
24 0.58
25 0.53
26 0.48
27 0.46
28 0.36
29 0.29
30 0.23
31 0.15
32 0.13
33 0.12
34 0.12
35 0.13
36 0.14
37 0.14
38 0.17
39 0.25
40 0.3
41 0.33
42 0.38