Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G8K7

Protein Details
Accession A0A2I1G8K7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-53DKDHVEKKRQVKNIENPFKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 5, cyto 4.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003388  Reticulon  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF02453  Reticulon  
PROSITE View protein in PROSITE  
PS50845  RETICULON  
Amino Acid Sequences MEPTKETQKELIEETTNMLEKLKEVTANPSTQNDKDHVEKKRQVKNIENPFKNLTHRVTQLVYWENPTHSGAILAASLSFLIFTAYYSLFNTFFALAAILIGVNWIYVMGFKQFQSLINQKPVNPHEHLLVNKPWYIEREDAEKYLDSIIDTANFVLLEAQRIALVDDPMRTMRHVFMFYILWTLGTWISFRTLFGIGLILSFSTPITYQKNKEFVDEKLYQFNKFLRSHFDRGLTMAKQHSGGVYEKAKSFAVTKGLVNDDKTAKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.25
5 0.22
6 0.17
7 0.16
8 0.19
9 0.18
10 0.16
11 0.16
12 0.23
13 0.27
14 0.3
15 0.31
16 0.33
17 0.36
18 0.35
19 0.37
20 0.33
21 0.33
22 0.37
23 0.43
24 0.44
25 0.49
26 0.55
27 0.62
28 0.68
29 0.71
30 0.71
31 0.73
32 0.76
33 0.78
34 0.81
35 0.74
36 0.69
37 0.66
38 0.61
39 0.56
40 0.51
41 0.44
42 0.39
43 0.39
44 0.38
45 0.35
46 0.32
47 0.33
48 0.32
49 0.29
50 0.27
51 0.27
52 0.24
53 0.25
54 0.25
55 0.2
56 0.15
57 0.15
58 0.1
59 0.09
60 0.08
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.06
72 0.07
73 0.07
74 0.08
75 0.1
76 0.1
77 0.1
78 0.11
79 0.09
80 0.08
81 0.08
82 0.07
83 0.05
84 0.05
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.05
97 0.06
98 0.06
99 0.08
100 0.09
101 0.1
102 0.15
103 0.2
104 0.22
105 0.28
106 0.29
107 0.28
108 0.34
109 0.35
110 0.35
111 0.31
112 0.29
113 0.24
114 0.26
115 0.26
116 0.24
117 0.24
118 0.21
119 0.2
120 0.2
121 0.18
122 0.17
123 0.19
124 0.16
125 0.15
126 0.18
127 0.18
128 0.18
129 0.18
130 0.17
131 0.14
132 0.13
133 0.12
134 0.07
135 0.07
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.1
157 0.1
158 0.11
159 0.11
160 0.12
161 0.14
162 0.14
163 0.13
164 0.14
165 0.14
166 0.14
167 0.14
168 0.12
169 0.1
170 0.08
171 0.09
172 0.07
173 0.07
174 0.07
175 0.06
176 0.08
177 0.08
178 0.08
179 0.1
180 0.1
181 0.1
182 0.1
183 0.1
184 0.08
185 0.08
186 0.08
187 0.05
188 0.04
189 0.05
190 0.04
191 0.04
192 0.05
193 0.09
194 0.15
195 0.2
196 0.25
197 0.31
198 0.4
199 0.39
200 0.44
201 0.43
202 0.39
203 0.42
204 0.43
205 0.38
206 0.4
207 0.41
208 0.37
209 0.37
210 0.38
211 0.38
212 0.36
213 0.36
214 0.35
215 0.41
216 0.46
217 0.47
218 0.47
219 0.4
220 0.41
221 0.45
222 0.37
223 0.34
224 0.31
225 0.29
226 0.26
227 0.25
228 0.23
229 0.2
230 0.21
231 0.23
232 0.25
233 0.26
234 0.26
235 0.28
236 0.28
237 0.26
238 0.26
239 0.24
240 0.25
241 0.24
242 0.24
243 0.27
244 0.32
245 0.34
246 0.34
247 0.35
248 0.37
249 0.39