Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GVR0

Protein Details
Accession A0A2I1GVR0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-34HHSFLSPKKSTTKRKKRSANCFLLFRHydrophilic
NLS Segment(s)
PositionSequence
20-24TKRKK
Subcellular Location(s) nucl 13.5, mito_nucl 13.166, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MINNLYVVHHSFLSPKKSTTKRKKRSANCFLLFRQEMMKERPYKMKMSNYSKRVSEMWQNLSEDEKIEMEETI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.37
4 0.46
5 0.57
6 0.63
7 0.69
8 0.73
9 0.81
10 0.89
11 0.89
12 0.91
13 0.9
14 0.89
15 0.82
16 0.77
17 0.67
18 0.64
19 0.54
20 0.43
21 0.35
22 0.27
23 0.25
24 0.24
25 0.29
26 0.25
27 0.27
28 0.34
29 0.35
30 0.37
31 0.4
32 0.45
33 0.48
34 0.55
35 0.61
36 0.58
37 0.6
38 0.56
39 0.54
40 0.47
41 0.41
42 0.41
43 0.39
44 0.4
45 0.4
46 0.4
47 0.38
48 0.39
49 0.35
50 0.27
51 0.22
52 0.17
53 0.14