Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PBV9

Protein Details
Accession J3PBV9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-58ILKRIAFKKRSKKKYFGAINLKQQRQPKKERKTLKTKQPNKGPIQNFHydrophilic
NLS Segment(s)
PositionSequence
14-51KRIAFKKRSKKKYFGAINLKQQRQPKKERKTLKTKQPN
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MANAFNVNNLGILKRIAFKKRSKKKYFGAINLKQQRQPKKERKTLKTKQPNKGPIQNFGLKLTRFLILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.27
4 0.34
5 0.42
6 0.53
7 0.63
8 0.73
9 0.75
10 0.77
11 0.77
12 0.8
13 0.79
14 0.77
15 0.77
16 0.72
17 0.74
18 0.74
19 0.69
20 0.63
21 0.62
22 0.61
23 0.58
24 0.62
25 0.63
26 0.64
27 0.72
28 0.78
29 0.8
30 0.82
31 0.84
32 0.85
33 0.86
34 0.85
35 0.86
36 0.86
37 0.86
38 0.83
39 0.84
40 0.75
41 0.71
42 0.68
43 0.64
44 0.56
45 0.51
46 0.49
47 0.4
48 0.39
49 0.35