Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P944

Protein Details
Accession J3P944    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
311-332MDEMRRKLRSIEKKTKTRARVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8cyto_nucl 8, cyto 6, pero 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006941  RNase_CAF1  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF04857  CAF1  
Amino Acid Sequences MESAREITAIDADNFWSLLPAVLEDIAAAELIGLDLEMTGVRLRDGIFGRKVKFMAEQCYVEAAEAAKAFQILEVGITCLRYGPEDKSYHWKGYSFQLAPWYLGNEAGNLALAKFLDRRFSLSGNTASFLRASRGDDLPARVLSKGITYLSRQEAQDAYDNFVDPDARNTPLINIDGESPTVRDFCASVRKQITDWLFKRGEHFINIENPEGDRLTSLQTRLIYQLLETDFKEYGLRGKRKGDCLFMQITIKGADKYQEKTLSRQMRDRKLAVRHQTGFRYVFEALAGGDFAEEIDVQLLLEPGAHSQDKMDEMRRKLRSIEKKTKTRARVLILHNSLLDLCFLYQSFVGDLPRTLTQFKLDLQAFPRLVDTKFMVTLGRHEFDPDISLGQLYKMVKNLELPLIAPPMPSIRVAHEAGYDSWLTAVAFLKFSWKLGQDRQLLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.08
13 0.07
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.05
27 0.06
28 0.06
29 0.08
30 0.08
31 0.14
32 0.18
33 0.24
34 0.3
35 0.36
36 0.39
37 0.42
38 0.41
39 0.38
40 0.42
41 0.39
42 0.38
43 0.38
44 0.37
45 0.34
46 0.36
47 0.34
48 0.26
49 0.23
50 0.16
51 0.13
52 0.12
53 0.11
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.05
60 0.06
61 0.06
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.13
70 0.15
71 0.22
72 0.25
73 0.28
74 0.36
75 0.4
76 0.42
77 0.41
78 0.39
79 0.33
80 0.38
81 0.44
82 0.35
83 0.32
84 0.35
85 0.34
86 0.33
87 0.32
88 0.27
89 0.18
90 0.19
91 0.17
92 0.11
93 0.11
94 0.09
95 0.09
96 0.08
97 0.07
98 0.06
99 0.06
100 0.07
101 0.1
102 0.11
103 0.15
104 0.15
105 0.19
106 0.21
107 0.23
108 0.24
109 0.25
110 0.28
111 0.24
112 0.25
113 0.21
114 0.19
115 0.18
116 0.17
117 0.15
118 0.13
119 0.14
120 0.17
121 0.17
122 0.19
123 0.21
124 0.22
125 0.22
126 0.22
127 0.2
128 0.17
129 0.16
130 0.14
131 0.12
132 0.12
133 0.11
134 0.11
135 0.12
136 0.16
137 0.19
138 0.22
139 0.22
140 0.22
141 0.21
142 0.22
143 0.26
144 0.23
145 0.22
146 0.19
147 0.19
148 0.17
149 0.17
150 0.16
151 0.1
152 0.13
153 0.12
154 0.13
155 0.13
156 0.13
157 0.14
158 0.15
159 0.15
160 0.12
161 0.1
162 0.11
163 0.11
164 0.11
165 0.1
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.07
172 0.08
173 0.18
174 0.18
175 0.24
176 0.26
177 0.27
178 0.27
179 0.32
180 0.34
181 0.34
182 0.34
183 0.35
184 0.34
185 0.34
186 0.36
187 0.35
188 0.32
189 0.24
190 0.24
191 0.19
192 0.24
193 0.25
194 0.23
195 0.19
196 0.17
197 0.16
198 0.15
199 0.13
200 0.07
201 0.06
202 0.09
203 0.1
204 0.1
205 0.11
206 0.12
207 0.13
208 0.13
209 0.13
210 0.1
211 0.09
212 0.12
213 0.11
214 0.12
215 0.11
216 0.12
217 0.12
218 0.12
219 0.12
220 0.09
221 0.14
222 0.22
223 0.25
224 0.26
225 0.33
226 0.37
227 0.44
228 0.46
229 0.44
230 0.37
231 0.38
232 0.37
233 0.31
234 0.28
235 0.21
236 0.19
237 0.16
238 0.15
239 0.12
240 0.1
241 0.13
242 0.15
243 0.17
244 0.21
245 0.27
246 0.27
247 0.3
248 0.39
249 0.43
250 0.43
251 0.48
252 0.52
253 0.54
254 0.58
255 0.58
256 0.55
257 0.54
258 0.6
259 0.6
260 0.6
261 0.55
262 0.54
263 0.53
264 0.51
265 0.45
266 0.37
267 0.32
268 0.25
269 0.21
270 0.16
271 0.14
272 0.1
273 0.08
274 0.07
275 0.04
276 0.04
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.08
292 0.08
293 0.08
294 0.08
295 0.1
296 0.13
297 0.15
298 0.23
299 0.27
300 0.31
301 0.41
302 0.43
303 0.43
304 0.45
305 0.53
306 0.56
307 0.6
308 0.66
309 0.67
310 0.73
311 0.81
312 0.85
313 0.81
314 0.79
315 0.75
316 0.7
317 0.69
318 0.66
319 0.66
320 0.59
321 0.54
322 0.45
323 0.39
324 0.33
325 0.24
326 0.19
327 0.1
328 0.07
329 0.07
330 0.07
331 0.07
332 0.07
333 0.08
334 0.08
335 0.1
336 0.11
337 0.11
338 0.11
339 0.13
340 0.15
341 0.16
342 0.16
343 0.16
344 0.17
345 0.18
346 0.19
347 0.24
348 0.23
349 0.25
350 0.27
351 0.34
352 0.32
353 0.3
354 0.31
355 0.26
356 0.26
357 0.25
358 0.25
359 0.19
360 0.2
361 0.2
362 0.19
363 0.17
364 0.23
365 0.25
366 0.24
367 0.22
368 0.23
369 0.23
370 0.22
371 0.24
372 0.19
373 0.14
374 0.12
375 0.13
376 0.11
377 0.11
378 0.15
379 0.14
380 0.15
381 0.18
382 0.19
383 0.2
384 0.23
385 0.25
386 0.24
387 0.23
388 0.22
389 0.21
390 0.23
391 0.22
392 0.19
393 0.17
394 0.17
395 0.18
396 0.18
397 0.17
398 0.17
399 0.22
400 0.23
401 0.24
402 0.23
403 0.25
404 0.24
405 0.25
406 0.21
407 0.16
408 0.15
409 0.15
410 0.12
411 0.11
412 0.13
413 0.11
414 0.12
415 0.12
416 0.18
417 0.18
418 0.2
419 0.23
420 0.26
421 0.31
422 0.38
423 0.47
424 0.5