Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GM79

Protein Details
Accession A0A2I1GM79   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-53SESSSSTKFNKSRRNKHPRKKQRTNSQDYTDHydrophilic
NLS Segment(s)
PositionSequence
33-44KSRRNKHPRKKQ
Subcellular Location(s) nucl 18, cyto_nucl 13, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019147  SWAP_N_domain  
Pfam View protein in Pfam  
PF09750  DRY_EERY  
Amino Acid Sequences MFFSETLLPEPSQSEQRPSNNWSESSSSTKFNKSRRNKHPRKKQRTNSQDYTDLLVFGYEAKTFRDNEMSQKVNNGELLIPWRGENENKILLDRVKGIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.36
4 0.4
5 0.42
6 0.47
7 0.42
8 0.42
9 0.39
10 0.37
11 0.36
12 0.38
13 0.36
14 0.33
15 0.33
16 0.39
17 0.42
18 0.45
19 0.53
20 0.57
21 0.65
22 0.71
23 0.8
24 0.83
25 0.89
26 0.92
27 0.93
28 0.94
29 0.94
30 0.93
31 0.93
32 0.92
33 0.9
34 0.85
35 0.78
36 0.7
37 0.6
38 0.53
39 0.41
40 0.31
41 0.22
42 0.15
43 0.11
44 0.08
45 0.07
46 0.05
47 0.06
48 0.07
49 0.1
50 0.11
51 0.12
52 0.18
53 0.18
54 0.24
55 0.3
56 0.3
57 0.29
58 0.32
59 0.32
60 0.27
61 0.26
62 0.21
63 0.14
64 0.13
65 0.17
66 0.14
67 0.14
68 0.13
69 0.14
70 0.16
71 0.18
72 0.2
73 0.22
74 0.26
75 0.26
76 0.27
77 0.29
78 0.28
79 0.29