Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P166

Protein Details
Accession J3P166    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
175-199TLACCRSSDTKPHRRPPPGRWLGRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRIRVDTRGSWHAPVRKGGILIPTTVSCRRTPLPFPLIGTSATTLTARDPSTHHTLYMSCMSTIGKGSAIAARYVQKPHRATVVRRRDALNGKRAVLSLPTTSCAKTCTLCDIGSKPLVTADHEMWKSGWVHGYSGGRPIPSLDEQDRTPWPPPGYRQLYARIGHLVPPSATATTLACCRSSDTKPHRRPPPGRWLGRASDSIGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.41
4 0.39
5 0.37
6 0.36
7 0.3
8 0.27
9 0.25
10 0.22
11 0.24
12 0.27
13 0.28
14 0.22
15 0.27
16 0.29
17 0.32
18 0.35
19 0.39
20 0.41
21 0.4
22 0.42
23 0.4
24 0.37
25 0.33
26 0.29
27 0.22
28 0.17
29 0.16
30 0.13
31 0.11
32 0.11
33 0.14
34 0.13
35 0.13
36 0.14
37 0.19
38 0.26
39 0.26
40 0.25
41 0.22
42 0.22
43 0.24
44 0.27
45 0.22
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.12
52 0.08
53 0.07
54 0.08
55 0.1
56 0.1
57 0.1
58 0.1
59 0.13
60 0.15
61 0.2
62 0.22
63 0.28
64 0.29
65 0.3
66 0.37
67 0.38
68 0.42
69 0.48
70 0.55
71 0.51
72 0.51
73 0.52
74 0.49
75 0.54
76 0.54
77 0.51
78 0.43
79 0.4
80 0.38
81 0.37
82 0.31
83 0.23
84 0.19
85 0.13
86 0.11
87 0.12
88 0.12
89 0.12
90 0.12
91 0.12
92 0.11
93 0.11
94 0.11
95 0.13
96 0.14
97 0.14
98 0.16
99 0.16
100 0.17
101 0.18
102 0.18
103 0.13
104 0.13
105 0.13
106 0.13
107 0.14
108 0.13
109 0.18
110 0.18
111 0.19
112 0.17
113 0.19
114 0.18
115 0.16
116 0.18
117 0.12
118 0.13
119 0.16
120 0.18
121 0.17
122 0.2
123 0.2
124 0.17
125 0.16
126 0.16
127 0.16
128 0.16
129 0.2
130 0.18
131 0.2
132 0.2
133 0.24
134 0.26
135 0.26
136 0.26
137 0.27
138 0.27
139 0.29
140 0.32
141 0.39
142 0.42
143 0.42
144 0.43
145 0.44
146 0.48
147 0.45
148 0.42
149 0.36
150 0.3
151 0.32
152 0.3
153 0.26
154 0.19
155 0.2
156 0.2
157 0.17
158 0.17
159 0.13
160 0.13
161 0.13
162 0.16
163 0.15
164 0.14
165 0.15
166 0.19
167 0.24
168 0.27
169 0.36
170 0.43
171 0.53
172 0.62
173 0.72
174 0.77
175 0.82
176 0.86
177 0.84
178 0.85
179 0.85
180 0.81
181 0.78
182 0.74
183 0.69
184 0.65
185 0.59