Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GZE9

Protein Details
Accession A0A2I1GZE9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-77AGHVAHEKRKYKRKSFIKKREFINQLNHydrophilic
NLS Segment(s)
PositionSequence
55-70AHEKRKYKRKSFIKKR
Subcellular Location(s) E.R. 8, nucl 5, cyto_nucl 4.5, extr 4, pero 3, mito 2, cyto 2, golg 2
Family & Domain DBs
Amino Acid Sequences MVQNKIFFILFFMILLIISVQSVQSPKNSTGEYRKYRGVGNREDARKGEDAGHVAHEKRKYKRKSFIKKREFINQLNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.06
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.09
12 0.13
13 0.14
14 0.17
15 0.18
16 0.2
17 0.27
18 0.36
19 0.38
20 0.38
21 0.4
22 0.38
23 0.4
24 0.43
25 0.41
26 0.35
27 0.37
28 0.41
29 0.41
30 0.41
31 0.38
32 0.35
33 0.31
34 0.27
35 0.22
36 0.17
37 0.16
38 0.15
39 0.18
40 0.17
41 0.18
42 0.22
43 0.26
44 0.32
45 0.4
46 0.49
47 0.55
48 0.63
49 0.72
50 0.78
51 0.83
52 0.88
53 0.9
54 0.91
55 0.89
56 0.85
57 0.85
58 0.82