Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GQI6

Protein Details
Accession A0A2I1GQI6    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
98-125KDNDIKIVNRNNKKKKEQKERIDLVKLLHydrophilic
NLS Segment(s)
PositionSequence
110-113KKKK
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MTKDSQRQLEQLEDEERVYLSNFGVNVVSKVLKSRVIVADRAKESCELLEESKLNEVQAEFVKRLWNFFNKCIRFCEIKSEKQDYVEDPINQKKLSEKDNDIKIVNRNNKKKKEQKERIDLVKLLEVSEACFIGQQMFTAIYNNKIAIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.21
4 0.16
5 0.15
6 0.12
7 0.09
8 0.1
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.12
15 0.12
16 0.1
17 0.13
18 0.14
19 0.16
20 0.16
21 0.21
22 0.25
23 0.27
24 0.32
25 0.33
26 0.38
27 0.37
28 0.37
29 0.33
30 0.27
31 0.25
32 0.21
33 0.19
34 0.14
35 0.13
36 0.16
37 0.15
38 0.15
39 0.17
40 0.17
41 0.14
42 0.13
43 0.11
44 0.1
45 0.13
46 0.14
47 0.12
48 0.13
49 0.17
50 0.17
51 0.18
52 0.19
53 0.24
54 0.24
55 0.3
56 0.39
57 0.37
58 0.38
59 0.39
60 0.4
61 0.35
62 0.33
63 0.38
64 0.33
65 0.37
66 0.41
67 0.43
68 0.4
69 0.39
70 0.4
71 0.31
72 0.3
73 0.28
74 0.24
75 0.23
76 0.28
77 0.28
78 0.27
79 0.26
80 0.26
81 0.26
82 0.29
83 0.31
84 0.32
85 0.37
86 0.42
87 0.44
88 0.4
89 0.4
90 0.41
91 0.45
92 0.48
93 0.5
94 0.56
95 0.63
96 0.71
97 0.79
98 0.83
99 0.85
100 0.87
101 0.88
102 0.88
103 0.89
104 0.87
105 0.84
106 0.8
107 0.71
108 0.61
109 0.55
110 0.45
111 0.35
112 0.28
113 0.21
114 0.17
115 0.16
116 0.14
117 0.09
118 0.1
119 0.09
120 0.1
121 0.1
122 0.09
123 0.09
124 0.1
125 0.1
126 0.14
127 0.15
128 0.17
129 0.18