Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G0M2

Protein Details
Accession A0A2I1G0M2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-70LILKNKSERKWKVRYSNKAKGICHydrophilic
81-102SLRQKNGKTRIRKSRKIHKFVGBasic
NLS Segment(s)
PositionSequence
86-97NGKTRIRKSRKI
Subcellular Location(s) nucl 14, mito_nucl 12.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSNINISPHLILTPIQKEQLRSIPISEFTDKKWESQNDAASFLNKHNLILKNKSERKWKVRYSNKAKGICLLQCCCGSDMSLRQKNGKTRIRKSRKIHKFVGCLAFARIKKFKNESIHISGYLSHSGDCQRQDPSYTLDGPFKNNVFAMFYFRFYKLILDKEFPNLLPHKKLAKAGEMWESLPTELKNSFNLYHKRERSLNEFKKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.28
4 0.3
5 0.35
6 0.4
7 0.38
8 0.34
9 0.34
10 0.32
11 0.33
12 0.36
13 0.35
14 0.3
15 0.28
16 0.36
17 0.35
18 0.34
19 0.4
20 0.38
21 0.4
22 0.45
23 0.5
24 0.42
25 0.44
26 0.42
27 0.35
28 0.34
29 0.28
30 0.28
31 0.2
32 0.2
33 0.24
34 0.3
35 0.34
36 0.39
37 0.44
38 0.49
39 0.56
40 0.61
41 0.64
42 0.66
43 0.69
44 0.73
45 0.74
46 0.75
47 0.78
48 0.83
49 0.83
50 0.84
51 0.84
52 0.79
53 0.7
54 0.63
55 0.57
56 0.49
57 0.44
58 0.36
59 0.3
60 0.27
61 0.27
62 0.24
63 0.2
64 0.17
65 0.14
66 0.2
67 0.27
68 0.31
69 0.31
70 0.35
71 0.39
72 0.45
73 0.52
74 0.52
75 0.52
76 0.56
77 0.66
78 0.71
79 0.77
80 0.79
81 0.8
82 0.83
83 0.81
84 0.8
85 0.75
86 0.69
87 0.65
88 0.61
89 0.51
90 0.41
91 0.35
92 0.33
93 0.27
94 0.27
95 0.26
96 0.23
97 0.27
98 0.3
99 0.35
100 0.36
101 0.39
102 0.41
103 0.42
104 0.42
105 0.38
106 0.35
107 0.3
108 0.24
109 0.22
110 0.16
111 0.1
112 0.1
113 0.12
114 0.14
115 0.15
116 0.15
117 0.15
118 0.16
119 0.18
120 0.18
121 0.2
122 0.2
123 0.21
124 0.21
125 0.24
126 0.24
127 0.25
128 0.27
129 0.23
130 0.21
131 0.2
132 0.18
133 0.16
134 0.16
135 0.2
136 0.17
137 0.2
138 0.22
139 0.22
140 0.22
141 0.2
142 0.24
143 0.21
144 0.26
145 0.26
146 0.26
147 0.27
148 0.3
149 0.32
150 0.28
151 0.3
152 0.29
153 0.3
154 0.31
155 0.35
156 0.35
157 0.37
158 0.42
159 0.39
160 0.4
161 0.38
162 0.38
163 0.4
164 0.36
165 0.34
166 0.3
167 0.28
168 0.23
169 0.23
170 0.2
171 0.17
172 0.17
173 0.18
174 0.19
175 0.22
176 0.25
177 0.31
178 0.39
179 0.43
180 0.52
181 0.54
182 0.58
183 0.6
184 0.62
185 0.62
186 0.66
187 0.67