Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GIC1

Protein Details
Accession A0A2I1GIC1   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
248-273DWTRYFTPNLKQRRRNPQKVNQDGDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSPKQIPDAFESVENQPMDIKILDTPKTPKHQSKAAAQQMEPIRSLSAKATPFTPKGKQKRVSYADMVKQDLKDDVSRPNPPSPSMYKKRKTAPVSHANNSSSPSKTYKKQTAAPSPKTINTMMTGYEPMNKDLIREIMVYDIPSTWSQLDTLNHLKAWGQFLTNWDLKQRKERERFQAMLKEVPASVTTATLYLDNPAHSILAPLGCKAFKLIQDRGNRKLITYYESWTDLEKVLDMSFSLDEFTGDWTRYFTPNLKQRRRNPQKVNQDGDSKVQTNSNTNQSSNKHKVTKEIKKIDKVLGGIDKLTVLAEIRSMFRKLGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.22
4 0.21
5 0.21
6 0.18
7 0.17
8 0.15
9 0.2
10 0.22
11 0.25
12 0.3
13 0.35
14 0.44
15 0.51
16 0.55
17 0.56
18 0.61
19 0.63
20 0.67
21 0.7
22 0.7
23 0.67
24 0.59
25 0.61
26 0.59
27 0.56
28 0.47
29 0.37
30 0.29
31 0.24
32 0.26
33 0.2
34 0.21
35 0.2
36 0.2
37 0.23
38 0.28
39 0.31
40 0.36
41 0.42
42 0.46
43 0.55
44 0.64
45 0.69
46 0.7
47 0.76
48 0.76
49 0.74
50 0.71
51 0.69
52 0.66
53 0.61
54 0.57
55 0.49
56 0.44
57 0.38
58 0.33
59 0.27
60 0.23
61 0.22
62 0.25
63 0.28
64 0.34
65 0.36
66 0.4
67 0.4
68 0.38
69 0.42
70 0.41
71 0.46
72 0.51
73 0.57
74 0.58
75 0.63
76 0.7
77 0.73
78 0.72
79 0.71
80 0.71
81 0.71
82 0.71
83 0.69
84 0.66
85 0.58
86 0.53
87 0.47
88 0.41
89 0.31
90 0.27
91 0.28
92 0.27
93 0.32
94 0.39
95 0.45
96 0.47
97 0.52
98 0.58
99 0.64
100 0.69
101 0.68
102 0.66
103 0.6
104 0.57
105 0.53
106 0.45
107 0.34
108 0.26
109 0.22
110 0.16
111 0.15
112 0.14
113 0.12
114 0.16
115 0.16
116 0.15
117 0.16
118 0.15
119 0.14
120 0.14
121 0.15
122 0.12
123 0.11
124 0.1
125 0.09
126 0.1
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.09
133 0.08
134 0.08
135 0.08
136 0.1
137 0.11
138 0.14
139 0.17
140 0.17
141 0.16
142 0.16
143 0.17
144 0.15
145 0.17
146 0.13
147 0.1
148 0.1
149 0.12
150 0.17
151 0.18
152 0.16
153 0.19
154 0.22
155 0.22
156 0.31
157 0.37
158 0.42
159 0.49
160 0.55
161 0.59
162 0.63
163 0.64
164 0.59
165 0.58
166 0.5
167 0.44
168 0.38
169 0.3
170 0.23
171 0.21
172 0.17
173 0.11
174 0.09
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.08
189 0.07
190 0.08
191 0.08
192 0.08
193 0.09
194 0.09
195 0.09
196 0.11
197 0.12
198 0.15
199 0.21
200 0.26
201 0.31
202 0.41
203 0.46
204 0.49
205 0.53
206 0.48
207 0.43
208 0.42
209 0.37
210 0.31
211 0.28
212 0.25
213 0.21
214 0.23
215 0.23
216 0.2
217 0.2
218 0.17
219 0.15
220 0.13
221 0.11
222 0.1
223 0.09
224 0.08
225 0.08
226 0.07
227 0.07
228 0.07
229 0.06
230 0.07
231 0.07
232 0.11
233 0.11
234 0.12
235 0.12
236 0.14
237 0.16
238 0.18
239 0.2
240 0.21
241 0.28
242 0.35
243 0.46
244 0.54
245 0.62
246 0.69
247 0.78
248 0.85
249 0.87
250 0.89
251 0.88
252 0.89
253 0.89
254 0.86
255 0.79
256 0.74
257 0.65
258 0.6
259 0.55
260 0.45
261 0.37
262 0.35
263 0.32
264 0.31
265 0.34
266 0.38
267 0.36
268 0.36
269 0.41
270 0.42
271 0.5
272 0.52
273 0.56
274 0.54
275 0.52
276 0.61
277 0.65
278 0.71
279 0.72
280 0.75
281 0.75
282 0.76
283 0.8
284 0.75
285 0.69
286 0.59
287 0.54
288 0.49
289 0.42
290 0.34
291 0.3
292 0.25
293 0.2
294 0.19
295 0.14
296 0.09
297 0.07
298 0.09
299 0.11
300 0.13
301 0.17
302 0.18
303 0.18