Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSP2

Protein Details
Accession A0A2I1HSP2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35IYKKSTNTSKRNKSAKTNKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.833, mito 5.5, cyto_mito 4.333
Family & Domain DBs
Amino Acid Sequences MRTLDTLFTSTEVSTIYKKSTNTSKRNKSAKTNKNVFTYDYLRRLSIHRYIQLLLDGRSKMDASNQIAQTMWDKCDYITRCIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.18
5 0.19
6 0.24
7 0.33
8 0.41
9 0.49
10 0.58
11 0.65
12 0.71
13 0.79
14 0.79
15 0.79
16 0.8
17 0.8
18 0.79
19 0.78
20 0.73
21 0.7
22 0.66
23 0.57
24 0.5
25 0.46
26 0.4
27 0.36
28 0.31
29 0.26
30 0.26
31 0.26
32 0.25
33 0.27
34 0.26
35 0.24
36 0.25
37 0.25
38 0.25
39 0.27
40 0.24
41 0.19
42 0.2
43 0.17
44 0.16
45 0.16
46 0.16
47 0.13
48 0.15
49 0.2
50 0.21
51 0.28
52 0.29
53 0.28
54 0.28
55 0.29
56 0.29
57 0.26
58 0.22
59 0.17
60 0.17
61 0.16
62 0.25
63 0.27
64 0.3