Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HJ12

Protein Details
Accession A0A2I1HJ12    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-94DWNRRITPFKKQSHKSKQDKKKNSKSSKGKKAGSKQPTSLIKSRDNSKKHTKKNDDTRSILNHydrophilic
NLS Segment(s)
PositionSequence
40-84PFKKQSHKSKQDKKKNSKSSKGKKAGSKQPTSLIKSRDNSKKHTK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPRQFVYKVFKGQPFDIYMRKTLKAKSFSGILDWNRRITPFKKQSHKSKQDKKKNSKSSKGKKAGSKQPTSLIKSRDNSKKHTKKNDDTRSILNLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.42
4 0.38
5 0.39
6 0.37
7 0.39
8 0.38
9 0.38
10 0.42
11 0.42
12 0.41
13 0.37
14 0.37
15 0.34
16 0.33
17 0.34
18 0.3
19 0.33
20 0.33
21 0.32
22 0.3
23 0.31
24 0.32
25 0.29
26 0.35
27 0.37
28 0.44
29 0.51
30 0.58
31 0.68
32 0.74
33 0.83
34 0.82
35 0.83
36 0.86
37 0.87
38 0.91
39 0.91
40 0.9
41 0.91
42 0.89
43 0.89
44 0.89
45 0.89
46 0.89
47 0.87
48 0.83
49 0.8
50 0.81
51 0.8
52 0.78
53 0.73
54 0.64
55 0.64
56 0.64
57 0.61
58 0.58
59 0.53
60 0.51
61 0.51
62 0.57
63 0.58
64 0.55
65 0.58
66 0.64
67 0.69
68 0.72
69 0.78
70 0.79
71 0.81
72 0.88
73 0.91
74 0.88
75 0.82
76 0.77
77 0.72