Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H8G4

Protein Details
Accession A0A2I1H8G4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-34VPSYASLTIRKRRNNRRHRITIDTIRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
Amino Acid Sequences MNRIPSNVPSYASLTIRKRRNNRRHRITIDTIRVGRLPTQITNNPSLHKDLILLHNNSQLVNYTATQAVDYLGQAHKWTDTDVVSSYKENMCEPCSDARIND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.49
4 0.56
5 0.63
6 0.7
7 0.79
8 0.83
9 0.86
10 0.88
11 0.9
12 0.87
13 0.85
14 0.82
15 0.8
16 0.76
17 0.7
18 0.6
19 0.51
20 0.46
21 0.38
22 0.31
23 0.25
24 0.21
25 0.17
26 0.21
27 0.24
28 0.26
29 0.3
30 0.29
31 0.28
32 0.27
33 0.27
34 0.22
35 0.19
36 0.17
37 0.13
38 0.18
39 0.21
40 0.21
41 0.2
42 0.22
43 0.22
44 0.21
45 0.19
46 0.14
47 0.11
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.12
69 0.14
70 0.16
71 0.17
72 0.17
73 0.19
74 0.19
75 0.2
76 0.21
77 0.22
78 0.21
79 0.22
80 0.24
81 0.26
82 0.28