Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HCH3

Protein Details
Accession A0A2I1HCH3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-99EKTNTLKKVQKHQYNAKRIERIKKRHYCRKBasic
NLS Segment(s)
PositionSequence
89-94ERIKKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MCNSKVERQFLEEICENCFLNIRTDIWLERCSKISEIEKGKGITMVDKKRKREDQSDVTTEISLEDGSEEKTNTLKKVQKHQYNAKRIERIKKRHYCRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.29
4 0.23
5 0.26
6 0.2
7 0.18
8 0.19
9 0.18
10 0.18
11 0.19
12 0.21
13 0.2
14 0.23
15 0.23
16 0.22
17 0.24
18 0.23
19 0.23
20 0.25
21 0.26
22 0.29
23 0.31
24 0.31
25 0.32
26 0.31
27 0.3
28 0.27
29 0.24
30 0.21
31 0.24
32 0.31
33 0.38
34 0.42
35 0.46
36 0.52
37 0.59
38 0.59
39 0.59
40 0.58
41 0.57
42 0.58
43 0.58
44 0.52
45 0.45
46 0.4
47 0.33
48 0.25
49 0.16
50 0.09
51 0.06
52 0.05
53 0.05
54 0.06
55 0.08
56 0.08
57 0.08
58 0.12
59 0.14
60 0.15
61 0.22
62 0.26
63 0.31
64 0.41
65 0.51
66 0.57
67 0.64
68 0.73
69 0.76
70 0.81
71 0.84
72 0.82
73 0.81
74 0.8
75 0.81
76 0.81
77 0.81
78 0.82
79 0.83