Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GX41

Protein Details
Accession A0A2I1GX41   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-34LGKVKPQKTTTNDKRNKKRTQEQVAYTHydrophilic
NLS Segment(s)
PositionSequence
36-40KKKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MFETGWNLGKVKPQKTTTNDKRNKKRTQEQVAYTEKKKRKLNNISKISKNQEPNQLDKNKPKKYAQSIKGEKLKEHHQIGQNKQMIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.65
4 0.67
5 0.71
6 0.76
7 0.78
8 0.84
9 0.85
10 0.89
11 0.87
12 0.86
13 0.85
14 0.87
15 0.84
16 0.78
17 0.76
18 0.74
19 0.7
20 0.63
21 0.62
22 0.56
23 0.56
24 0.58
25 0.56
26 0.59
27 0.65
28 0.72
29 0.73
30 0.78
31 0.76
32 0.74
33 0.74
34 0.68
35 0.62
36 0.57
37 0.51
38 0.51
39 0.48
40 0.48
41 0.5
42 0.52
43 0.51
44 0.56
45 0.62
46 0.59
47 0.62
48 0.63
49 0.63
50 0.67
51 0.73
52 0.7
53 0.71
54 0.72
55 0.75
56 0.77
57 0.7
58 0.62
59 0.56
60 0.57
61 0.54
62 0.52
63 0.5
64 0.51
65 0.58
66 0.62
67 0.67
68 0.64