Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GY69

Protein Details
Accession A0A2I1GY69   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-117QRTSGKETKSEKPKKQKKDKSRKASRSKVLAEIHydrophilic
NLS Segment(s)
PositionSequence
89-112GKETKSEKPKKQKKDKSRKASRSK
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
Amino Acid Sequences MTLAALWVDRLPHTFLSSIRGLKSFKIIQTARGERKLIGYFEKWVDMRTALDNQFLWDQQNLSWNRYEPPLQQTRSYGSNANKNQRTSGKETKSEKPKKQKKDKSRKASRSKVLAEIIDVLRKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.24
5 0.24
6 0.23
7 0.26
8 0.25
9 0.24
10 0.3
11 0.29
12 0.26
13 0.32
14 0.31
15 0.34
16 0.42
17 0.5
18 0.49
19 0.49
20 0.49
21 0.41
22 0.45
23 0.41
24 0.34
25 0.29
26 0.25
27 0.23
28 0.23
29 0.26
30 0.21
31 0.19
32 0.18
33 0.15
34 0.15
35 0.14
36 0.17
37 0.15
38 0.16
39 0.15
40 0.15
41 0.16
42 0.15
43 0.13
44 0.1
45 0.1
46 0.09
47 0.16
48 0.16
49 0.17
50 0.17
51 0.17
52 0.17
53 0.19
54 0.2
55 0.16
56 0.21
57 0.27
58 0.28
59 0.29
60 0.29
61 0.3
62 0.31
63 0.3
64 0.29
65 0.25
66 0.33
67 0.38
68 0.45
69 0.47
70 0.46
71 0.49
72 0.49
73 0.5
74 0.5
75 0.53
76 0.5
77 0.54
78 0.58
79 0.63
80 0.68
81 0.73
82 0.74
83 0.76
84 0.8
85 0.83
86 0.89
87 0.9
88 0.91
89 0.92
90 0.94
91 0.94
92 0.95
93 0.95
94 0.95
95 0.94
96 0.91
97 0.89
98 0.82
99 0.77
100 0.7
101 0.6
102 0.5
103 0.45
104 0.39
105 0.33