Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H6T9

Protein Details
Accession A0A2I1H6T9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-37YNPFEVKHRRRTSRQQLKVLHydrophilic
NLS Segment(s)
PositionSequence
74-79RAKAKK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MFDAFHQSPHGEFKPTFYNPFEVKHRRRTSRQQLKVLEKAFNENPKPHAAVRQALALKLNMTPRGVQVWFQNRRAKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.37
4 0.32
5 0.36
6 0.33
7 0.37
8 0.42
9 0.44
10 0.48
11 0.55
12 0.62
13 0.63
14 0.69
15 0.76
16 0.78
17 0.79
18 0.82
19 0.79
20 0.78
21 0.77
22 0.76
23 0.67
24 0.58
25 0.48
26 0.44
27 0.38
28 0.37
29 0.32
30 0.28
31 0.28
32 0.27
33 0.29
34 0.25
35 0.28
36 0.25
37 0.25
38 0.25
39 0.28
40 0.27
41 0.25
42 0.26
43 0.2
44 0.18
45 0.18
46 0.21
47 0.16
48 0.17
49 0.17
50 0.17
51 0.21
52 0.21
53 0.21
54 0.26
55 0.34
56 0.4
57 0.46
58 0.53
59 0.53