Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GYZ2

Protein Details
Accession A0A2I1GYZ2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
31-67EKNYYIKLKLDKRPKKNNRDGPKQKYDKKNNEKNDIEHydrophilic
NLS Segment(s)
PositionSequence
41-56DKRPKKNNRDGPKQKY
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences WQRFKKKYPNVTTQQFSSIAAEQWHRMTDSEKNYYIKLKLDKRPKKNNRDGPKQKYDKKNNEKNDIERDLSAESSLFHLQLDFNNYNENLYINNSTNQEDDNFLLTYPSYSLYDDANIFFDFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.53
3 0.45
4 0.38
5 0.3
6 0.24
7 0.22
8 0.21
9 0.19
10 0.2
11 0.2
12 0.17
13 0.16
14 0.18
15 0.22
16 0.27
17 0.3
18 0.33
19 0.33
20 0.34
21 0.37
22 0.36
23 0.34
24 0.37
25 0.39
26 0.44
27 0.53
28 0.62
29 0.68
30 0.78
31 0.82
32 0.85
33 0.87
34 0.89
35 0.87
36 0.89
37 0.9
38 0.87
39 0.87
40 0.85
41 0.83
42 0.83
43 0.84
44 0.83
45 0.83
46 0.84
47 0.8
48 0.8
49 0.75
50 0.69
51 0.66
52 0.58
53 0.49
54 0.39
55 0.34
56 0.26
57 0.22
58 0.18
59 0.11
60 0.08
61 0.09
62 0.09
63 0.08
64 0.07
65 0.07
66 0.08
67 0.09
68 0.16
69 0.14
70 0.14
71 0.17
72 0.17
73 0.17
74 0.17
75 0.16
76 0.09
77 0.12
78 0.14
79 0.13
80 0.17
81 0.18
82 0.19
83 0.19
84 0.2
85 0.18
86 0.17
87 0.16
88 0.16
89 0.14
90 0.13
91 0.13
92 0.12
93 0.12
94 0.1
95 0.11
96 0.1
97 0.11
98 0.12
99 0.12
100 0.15
101 0.15
102 0.16
103 0.16
104 0.15