Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NPL0

Protein Details
Accession J3NPL0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-64HPGRRGAPGRYRERRNRRPHRQSGRLRIRRGRBasic
NLS Segment(s)
PositionSequence
31-72GRHPGRRGAPGRYRERRNRRPHRQSGRLRIRRGRRRAAARPR
Subcellular Location(s) mito 19, extr 4, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MMWKYHRFALPPIFPVNTFLLLRRYPYYPPGRHPGRRGAPGRYRERRNRRPHRQSGRLRIRRGRRRAAARPRDEVADEAPADEEPEQTAPRLTARRTGRLAGALTRAGGDTGSAAVCGGGRWSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.34
4 0.28
5 0.24
6 0.22
7 0.23
8 0.23
9 0.26
10 0.25
11 0.25
12 0.23
13 0.31
14 0.39
15 0.38
16 0.43
17 0.49
18 0.55
19 0.59
20 0.61
21 0.62
22 0.59
23 0.64
24 0.62
25 0.61
26 0.61
27 0.64
28 0.7
29 0.68
30 0.71
31 0.73
32 0.8
33 0.81
34 0.85
35 0.87
36 0.88
37 0.9
38 0.92
39 0.91
40 0.91
41 0.89
42 0.89
43 0.89
44 0.86
45 0.81
46 0.78
47 0.79
48 0.78
49 0.76
50 0.73
51 0.69
52 0.7
53 0.74
54 0.77
55 0.77
56 0.71
57 0.68
58 0.61
59 0.55
60 0.47
61 0.38
62 0.28
63 0.21
64 0.17
65 0.13
66 0.12
67 0.1
68 0.11
69 0.1
70 0.08
71 0.06
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.13
78 0.17
79 0.17
80 0.24
81 0.28
82 0.35
83 0.37
84 0.38
85 0.36
86 0.35
87 0.36
88 0.3
89 0.29
90 0.22
91 0.2
92 0.18
93 0.16
94 0.13
95 0.11
96 0.08
97 0.06
98 0.06
99 0.06
100 0.06
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06