Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HDE4

Protein Details
Accession A0A2I1HDE4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-47KGKRICIQKKMMLREKKKKKNIRTKMTPYVKKNNFTKKKKVEKFFFHydrophilic
NLS Segment(s)
PositionSequence
11-41KMMLREKKKKKNIRTKMTPYVKKNNFTKKKK
76-82KKKKRRW
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MKGKRICIQKKMMLREKKKKKNIRTKMTPYVKKNNFTKKKKVEKFFFFDILIKKYQKNSKKSLIYFFFFISNYDDKKKKRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.87
5 0.9
6 0.9
7 0.91
8 0.92
9 0.92
10 0.92
11 0.91
12 0.89
13 0.89
14 0.89
15 0.87
16 0.82
17 0.82
18 0.77
19 0.74
20 0.73
21 0.73
22 0.73
23 0.71
24 0.75
25 0.74
26 0.8
27 0.81
28 0.82
29 0.79
30 0.74
31 0.74
32 0.67
33 0.59
34 0.49
35 0.44
36 0.38
37 0.33
38 0.31
39 0.27
40 0.25
41 0.3
42 0.38
43 0.42
44 0.46
45 0.51
46 0.56
47 0.63
48 0.64
49 0.66
50 0.63
51 0.58
52 0.53
53 0.47
54 0.39
55 0.31
56 0.29
57 0.25
58 0.24
59 0.25
60 0.31
61 0.38
62 0.43