Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GY96

Protein Details
Accession A0A2I1GY96   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-41SLEAIQKERRKIKKSIHKKLLQTSEDHydrophilic
NLS Segment(s)
PositionSequence
23-33ERRKIKKSIHK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MEFPPSESILQDYENSLEAIQKERRKIKKSIHKKLLQTSEDVGSSVQIDDNKSLKVLENDYHKIYLSEVNLSEKLMFTKQIYRLLFEFNDTQKSDEFKPFIEKYEEEVWINDMQNLDKEFLNTPYTIQKMLTVYENDETDEPDKILTKWYWQLKAYLRHVPSEKNLTSLELLLVDVVAYDITYNCNKPNKPMLKFSSRHSGHIIQICVTSDSINGRFKINFDLPLIKAIEKFHELSPSIDFPNFIKYVIWNEMDELFEYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.15
5 0.14
6 0.2
7 0.26
8 0.31
9 0.39
10 0.48
11 0.57
12 0.6
13 0.68
14 0.72
15 0.75
16 0.81
17 0.84
18 0.85
19 0.83
20 0.85
21 0.86
22 0.85
23 0.75
24 0.67
25 0.59
26 0.51
27 0.43
28 0.36
29 0.26
30 0.17
31 0.16
32 0.13
33 0.12
34 0.1
35 0.12
36 0.15
37 0.16
38 0.16
39 0.16
40 0.16
41 0.17
42 0.18
43 0.2
44 0.21
45 0.26
46 0.3
47 0.31
48 0.31
49 0.29
50 0.26
51 0.24
52 0.24
53 0.18
54 0.18
55 0.16
56 0.19
57 0.19
58 0.2
59 0.18
60 0.15
61 0.15
62 0.13
63 0.14
64 0.12
65 0.19
66 0.22
67 0.29
68 0.29
69 0.29
70 0.29
71 0.31
72 0.29
73 0.25
74 0.26
75 0.2
76 0.25
77 0.23
78 0.23
79 0.21
80 0.24
81 0.24
82 0.24
83 0.23
84 0.19
85 0.26
86 0.25
87 0.27
88 0.27
89 0.25
90 0.25
91 0.28
92 0.29
93 0.22
94 0.21
95 0.21
96 0.19
97 0.19
98 0.15
99 0.12
100 0.1
101 0.12
102 0.13
103 0.12
104 0.1
105 0.11
106 0.11
107 0.12
108 0.14
109 0.12
110 0.12
111 0.14
112 0.15
113 0.14
114 0.13
115 0.13
116 0.12
117 0.13
118 0.14
119 0.11
120 0.11
121 0.12
122 0.12
123 0.11
124 0.11
125 0.11
126 0.1
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.11
133 0.1
134 0.12
135 0.18
136 0.22
137 0.25
138 0.25
139 0.3
140 0.33
141 0.41
142 0.42
143 0.43
144 0.4
145 0.41
146 0.42
147 0.39
148 0.37
149 0.37
150 0.33
151 0.28
152 0.27
153 0.24
154 0.23
155 0.21
156 0.17
157 0.1
158 0.09
159 0.06
160 0.06
161 0.04
162 0.03
163 0.03
164 0.03
165 0.02
166 0.03
167 0.03
168 0.06
169 0.08
170 0.09
171 0.14
172 0.21
173 0.22
174 0.27
175 0.37
176 0.43
177 0.45
178 0.53
179 0.55
180 0.58
181 0.6
182 0.59
183 0.59
184 0.52
185 0.51
186 0.48
187 0.45
188 0.41
189 0.44
190 0.41
191 0.31
192 0.31
193 0.29
194 0.24
195 0.21
196 0.16
197 0.12
198 0.15
199 0.18
200 0.22
201 0.21
202 0.23
203 0.23
204 0.24
205 0.3
206 0.28
207 0.27
208 0.26
209 0.3
210 0.28
211 0.32
212 0.33
213 0.26
214 0.26
215 0.25
216 0.26
217 0.24
218 0.26
219 0.23
220 0.27
221 0.27
222 0.27
223 0.3
224 0.29
225 0.28
226 0.26
227 0.25
228 0.2
229 0.26
230 0.25
231 0.21
232 0.19
233 0.18
234 0.23
235 0.28
236 0.29
237 0.22
238 0.24
239 0.25
240 0.25