Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HQE9

Protein Details
Accession A0A2I1HQE9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
95-119GPQLYFKGLRRRRFRMPKDFNFEDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNLKKAKNKFWTSILKLKKAERQLKEAEKQVKEAERQVLDFYIKVKGSQKTSQTSILKKAEVYIKGKGIQKNFHIKGTTVQKTERQIPVFYFEGPQLYFKGLRRRRFRMPKDFNFEDFWLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.67
4 0.65
5 0.66
6 0.65
7 0.65
8 0.68
9 0.62
10 0.62
11 0.63
12 0.66
13 0.66
14 0.67
15 0.65
16 0.57
17 0.55
18 0.53
19 0.49
20 0.43
21 0.42
22 0.39
23 0.32
24 0.31
25 0.3
26 0.26
27 0.22
28 0.2
29 0.17
30 0.15
31 0.14
32 0.15
33 0.19
34 0.21
35 0.26
36 0.3
37 0.34
38 0.33
39 0.36
40 0.42
41 0.41
42 0.39
43 0.41
44 0.38
45 0.34
46 0.3
47 0.3
48 0.27
49 0.26
50 0.27
51 0.22
52 0.22
53 0.26
54 0.31
55 0.32
56 0.31
57 0.31
58 0.34
59 0.42
60 0.41
61 0.4
62 0.36
63 0.34
64 0.37
65 0.42
66 0.42
67 0.34
68 0.35
69 0.36
70 0.4
71 0.46
72 0.45
73 0.38
74 0.34
75 0.33
76 0.36
77 0.32
78 0.29
79 0.23
80 0.18
81 0.18
82 0.17
83 0.17
84 0.14
85 0.15
86 0.18
87 0.22
88 0.32
89 0.38
90 0.47
91 0.54
92 0.6
93 0.69
94 0.76
95 0.81
96 0.82
97 0.85
98 0.85
99 0.86
100 0.84
101 0.76
102 0.7