Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FZ38

Protein Details
Accession A0A2I1FZ38   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-124ESLHRIANKCKCNKKCKCPPSQYDLWLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003450  Replication_origin-bd  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003688  F:DNA replication origin binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF02399  Herpes_ori_bp  
Amino Acid Sequences MPSWVKYNEPLTATETYEERYVRPLSNEGDIYVGSPWEMGKTYILENLSIPDNVNLLVLSTQHSYSNAVTTRLDLKSYCDIDGNINLPDHKRVVCQIESLHRIANKCKCNKKCKCPPSQYDLWLDEIVSIIAQAQSHLAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.21
4 0.23
5 0.21
6 0.18
7 0.2
8 0.22
9 0.22
10 0.24
11 0.26
12 0.24
13 0.28
14 0.27
15 0.23
16 0.21
17 0.19
18 0.17
19 0.13
20 0.11
21 0.07
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.09
29 0.1
30 0.12
31 0.13
32 0.12
33 0.12
34 0.12
35 0.13
36 0.12
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.08
49 0.08
50 0.08
51 0.1
52 0.1
53 0.13
54 0.12
55 0.12
56 0.12
57 0.12
58 0.16
59 0.14
60 0.15
61 0.12
62 0.14
63 0.18
64 0.19
65 0.19
66 0.16
67 0.16
68 0.17
69 0.18
70 0.16
71 0.12
72 0.11
73 0.12
74 0.12
75 0.13
76 0.13
77 0.12
78 0.12
79 0.14
80 0.18
81 0.18
82 0.2
83 0.2
84 0.26
85 0.29
86 0.29
87 0.29
88 0.26
89 0.27
90 0.33
91 0.38
92 0.4
93 0.46
94 0.55
95 0.61
96 0.7
97 0.79
98 0.82
99 0.85
100 0.87
101 0.89
102 0.89
103 0.87
104 0.85
105 0.82
106 0.76
107 0.71
108 0.63
109 0.56
110 0.46
111 0.39
112 0.3
113 0.23
114 0.18
115 0.11
116 0.09
117 0.06
118 0.06
119 0.06
120 0.07