Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GVF4

Protein Details
Accession A0A2I1GVF4    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-36VPSDNFNRVIHKRRRRRIVNRKYRNAFNINHydrophilic
62-88PSDNYNRVIHKRRRRKAINKIYRNAVNHydrophilic
NLS Segment(s)
PositionSequence
17-27HKRRRRRIVNR
72-78KRRRRKA
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MTLKKHVPSDNFNRVIHKRRRRRIVNRKYRNAFNINTLNRLSRLPLQITNDPFANPRNLYVPSDNYNRVIHKRRRRKAINKIYRNAVNVNILSQLPLQITNDPFAVQLFFGSSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.67
4 0.68
5 0.69
6 0.74
7 0.83
8 0.86
9 0.91
10 0.92
11 0.93
12 0.93
13 0.93
14 0.94
15 0.89
16 0.85
17 0.81
18 0.75
19 0.65
20 0.61
21 0.59
22 0.5
23 0.47
24 0.41
25 0.36
26 0.31
27 0.29
28 0.25
29 0.2
30 0.22
31 0.21
32 0.23
33 0.26
34 0.3
35 0.31
36 0.3
37 0.26
38 0.23
39 0.22
40 0.2
41 0.18
42 0.14
43 0.13
44 0.14
45 0.14
46 0.16
47 0.17
48 0.18
49 0.19
50 0.23
51 0.23
52 0.23
53 0.24
54 0.25
55 0.3
56 0.37
57 0.42
58 0.49
59 0.59
60 0.65
61 0.74
62 0.81
63 0.85
64 0.87
65 0.89
66 0.89
67 0.87
68 0.84
69 0.81
70 0.74
71 0.67
72 0.57
73 0.48
74 0.41
75 0.32
76 0.28
77 0.23
78 0.19
79 0.17
80 0.15
81 0.14
82 0.1
83 0.11
84 0.12
85 0.15
86 0.16
87 0.17
88 0.17
89 0.16
90 0.15
91 0.15
92 0.14
93 0.1
94 0.09
95 0.09