Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GGE8

Protein Details
Accession A0A2I1GGE8    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
16-52NGEERNSKHNRKEKKDKARKRSESRPKKRKIDTGTKVBasic
NLS Segment(s)
PositionSequence
13-55RRRNGEERNSKHNRKEKKDKARKRSESRPKKRKIDTGTKVLKP
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MVGDEIVMEKNDRRRNGEERNSKHNRKEKKDKARKRSESRPKKRKIDTGTKVLKPLKGGKNYLQQSDEIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.59
4 0.65
5 0.67
6 0.65
7 0.72
8 0.76
9 0.76
10 0.77
11 0.74
12 0.74
13 0.73
14 0.79
15 0.79
16 0.82
17 0.86
18 0.88
19 0.9
20 0.91
21 0.91
22 0.88
23 0.88
24 0.88
25 0.88
26 0.9
27 0.89
28 0.88
29 0.87
30 0.86
31 0.83
32 0.81
33 0.81
34 0.76
35 0.76
36 0.75
37 0.67
38 0.68
39 0.62
40 0.55
41 0.49
42 0.52
43 0.5
44 0.49
45 0.51
46 0.51
47 0.58
48 0.61
49 0.61
50 0.53