Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HW57

Protein Details
Accession A0A2I1HW57   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-128ISEKKIPKAKCVKIKSGNKKVKPRRNPFRAVRSNHydrophilic
NLS Segment(s)
PositionSequence
98-125KKIPKAKCVKIKSGNKKVKPRRNPFRAV
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRSLESVLVSGKIRALEERLDDIDNRLDTLFSHSCPSELKKKVKKLERTVDWIGNYIEEQTGLEPGEEVDAPSGAESSDSDSTETFYVTSDEPNISEKKIPKAKCVKIKSGNKKVKPRRNPFRAVRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.19
5 0.22
6 0.22
7 0.23
8 0.22
9 0.23
10 0.25
11 0.22
12 0.2
13 0.16
14 0.14
15 0.13
16 0.2
17 0.19
18 0.15
19 0.18
20 0.17
21 0.18
22 0.2
23 0.24
24 0.26
25 0.33
26 0.42
27 0.47
28 0.56
29 0.65
30 0.71
31 0.77
32 0.77
33 0.79
34 0.74
35 0.73
36 0.68
37 0.63
38 0.54
39 0.46
40 0.37
41 0.27
42 0.22
43 0.15
44 0.1
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.07
65 0.08
66 0.09
67 0.1
68 0.1
69 0.11
70 0.11
71 0.11
72 0.08
73 0.07
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.13
81 0.14
82 0.14
83 0.19
84 0.22
85 0.3
86 0.37
87 0.38
88 0.45
89 0.54
90 0.61
91 0.66
92 0.7
93 0.7
94 0.73
95 0.82
96 0.84
97 0.84
98 0.86
99 0.85
100 0.9
101 0.91
102 0.91
103 0.92
104 0.92
105 0.92
106 0.91
107 0.91
108 0.9