Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1EED7

Protein Details
Accession A0A2I1EED7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGNGQKAQHKRERAKNDAKKGPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences MGNGQKAQHKRERAKNDAKKGPTSQLKTNEAAKNIVCQVCRNTFLCTVRKKALEEHADNKHGKKLEECFPGFVETAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.84
5 0.79
6 0.74
7 0.68
8 0.67
9 0.65
10 0.6
11 0.57
12 0.56
13 0.55
14 0.52
15 0.56
16 0.5
17 0.43
18 0.4
19 0.33
20 0.28
21 0.27
22 0.26
23 0.19
24 0.17
25 0.19
26 0.19
27 0.22
28 0.2
29 0.2
30 0.22
31 0.26
32 0.31
33 0.31
34 0.34
35 0.36
36 0.37
37 0.36
38 0.36
39 0.4
40 0.42
41 0.43
42 0.45
43 0.47
44 0.5
45 0.51
46 0.48
47 0.45
48 0.4
49 0.36
50 0.34
51 0.34
52 0.37
53 0.44
54 0.44
55 0.4
56 0.39
57 0.41
58 0.36
59 0.31