Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HJ93

Protein Details
Accession A0A2I1HJ93   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-88QATPRNHKDNDQKEKRKRYKRKMSHTTKTRQVRYFKBasic
NLS Segment(s)
PositionSequence
65-75KEKRKRYKRKM
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MENQMQNSIRYSVVSTTIEISKHIEIGKLIGRKGHIEKEEKNVRISDNGNHQQATPRNHKDNDQKEKRKRYKRKMSHTTKTRQVRYFKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.17
4 0.19
5 0.19
6 0.18
7 0.19
8 0.16
9 0.17
10 0.16
11 0.15
12 0.12
13 0.15
14 0.19
15 0.19
16 0.18
17 0.18
18 0.19
19 0.22
20 0.25
21 0.28
22 0.27
23 0.3
24 0.32
25 0.39
26 0.46
27 0.44
28 0.42
29 0.37
30 0.33
31 0.31
32 0.3
33 0.24
34 0.25
35 0.29
36 0.28
37 0.28
38 0.27
39 0.3
40 0.34
41 0.37
42 0.37
43 0.39
44 0.44
45 0.45
46 0.52
47 0.56
48 0.61
49 0.66
50 0.68
51 0.72
52 0.76
53 0.86
54 0.9
55 0.91
56 0.92
57 0.92
58 0.93
59 0.93
60 0.94
61 0.94
62 0.94
63 0.94
64 0.92
65 0.9
66 0.89
67 0.88
68 0.86
69 0.82
70 0.8